| Basic Information | |
|---|---|
| Family ID | F005073 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 413 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSGGWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW |
| Number of Associated Samples | 256 |
| Number of Associated Scaffolds | 413 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 29.20 % |
| % of genes near scaffold ends (potentially truncated) | 24.46 % |
| % of genes from short scaffolds (< 2000 bps) | 80.87 % |
| Associated GOLD sequencing projects | 241 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.567 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.138 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.266 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.383 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.99% β-sheet: 0.00% Coil/Unstructured: 63.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 413 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 26.15 |
| PF07075 | DUF1343 | 10.90 |
| PF13577 | SnoaL_4 | 8.47 |
| PF01070 | FMN_dh | 7.99 |
| PF07883 | Cupin_2 | 4.12 |
| PF13231 | PMT_2 | 3.87 |
| PF00975 | Thioesterase | 2.42 |
| PF13193 | AMP-binding_C | 1.21 |
| PF02366 | PMT | 0.97 |
| PF00920 | ILVD_EDD | 0.97 |
| PF01370 | Epimerase | 0.97 |
| PF00072 | Response_reg | 0.73 |
| PF01464 | SLT | 0.73 |
| PF13519 | VWA_2 | 0.48 |
| PF01041 | DegT_DnrJ_EryC1 | 0.48 |
| PF00550 | PP-binding | 0.48 |
| PF00106 | adh_short | 0.24 |
| PF13091 | PLDc_2 | 0.24 |
| PF00092 | VWA | 0.24 |
| PF03480 | DctP | 0.24 |
| PF06808 | DctM | 0.24 |
| PF03992 | ABM | 0.24 |
| PF01408 | GFO_IDH_MocA | 0.24 |
| PF13560 | HTH_31 | 0.24 |
| PF15943 | YdaS_antitoxin | 0.24 |
| PF02518 | HATPase_c | 0.24 |
| PF07726 | AAA_3 | 0.24 |
| PF00216 | Bac_DNA_binding | 0.24 |
| COG ID | Name | Functional Category | % Frequency in 413 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 26.15 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 10.90 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 7.99 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 7.99 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.94 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.48 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.48 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.48 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.48 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.48 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.24 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.81 % |
| Unclassified | root | N/A | 17.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_9186841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1197 | Open in IMG/M |
| 3300000956|JGI10216J12902_100217547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 778 | Open in IMG/M |
| 3300001686|C688J18823_10186533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 1407 | Open in IMG/M |
| 3300001686|C688J18823_10244165 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300003319|soilL2_10010272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 3645 | Open in IMG/M |
| 3300003319|soilL2_10069439 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300003324|soilH2_10110159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1153 | Open in IMG/M |
| 3300004022|Ga0055432_10006545 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
| 3300004114|Ga0062593_101019631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 850 | Open in IMG/M |
| 3300004114|Ga0062593_101487964 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300004156|Ga0062589_100947691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 798 | Open in IMG/M |
| 3300004156|Ga0062589_101838893 | Not Available | 609 | Open in IMG/M |
| 3300004157|Ga0062590_100065334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2116 | Open in IMG/M |
| 3300004157|Ga0062590_102470971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 550 | Open in IMG/M |
| 3300004463|Ga0063356_100010219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8402 | Open in IMG/M |
| 3300004463|Ga0063356_100131900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2802 | Open in IMG/M |
| 3300004463|Ga0063356_100137154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2755 | Open in IMG/M |
| 3300004463|Ga0063356_100190886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2401 | Open in IMG/M |
| 3300004463|Ga0063356_100242445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2175 | Open in IMG/M |
| 3300004463|Ga0063356_100396141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1773 | Open in IMG/M |
| 3300004463|Ga0063356_100910828 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300004463|Ga0063356_100926295 | Not Available | 1234 | Open in IMG/M |
| 3300004463|Ga0063356_101122274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1135 | Open in IMG/M |
| 3300004480|Ga0062592_101693469 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300004782|Ga0062382_10275180 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300004798|Ga0058859_11320720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300005093|Ga0062594_100108440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1685 | Open in IMG/M |
| 3300005093|Ga0062594_102514283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 566 | Open in IMG/M |
| 3300005294|Ga0065705_10049864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1205 | Open in IMG/M |
| 3300005294|Ga0065705_10374090 | Not Available | 906 | Open in IMG/M |
| 3300005294|Ga0065705_10703556 | Not Available | 651 | Open in IMG/M |
| 3300005328|Ga0070676_10732276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 724 | Open in IMG/M |
| 3300005330|Ga0070690_100523147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 890 | Open in IMG/M |
| 3300005330|Ga0070690_100674314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 792 | Open in IMG/M |
| 3300005332|Ga0066388_100165019 | Not Available | 2809 | Open in IMG/M |
| 3300005332|Ga0066388_102009068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1037 | Open in IMG/M |
| 3300005332|Ga0066388_103846425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300005336|Ga0070680_100249330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1501 | Open in IMG/M |
| 3300005336|Ga0070680_100383400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1197 | Open in IMG/M |
| 3300005338|Ga0068868_100586995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 986 | Open in IMG/M |
| 3300005341|Ga0070691_10944660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 535 | Open in IMG/M |
| 3300005406|Ga0070703_10463877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 563 | Open in IMG/M |
| 3300005438|Ga0070701_10724097 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005440|Ga0070705_100021606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3425 | Open in IMG/M |
| 3300005444|Ga0070694_100006938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6882 | Open in IMG/M |
| 3300005444|Ga0070694_100457515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1009 | Open in IMG/M |
| 3300005444|Ga0070694_100631020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
| 3300005444|Ga0070694_100776752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 784 | Open in IMG/M |
| 3300005446|Ga0066686_10482077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus | 845 | Open in IMG/M |
| 3300005450|Ga0066682_10404507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300005455|Ga0070663_100244735 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300005526|Ga0073909_10207967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 849 | Open in IMG/M |
| 3300005526|Ga0073909_10267896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 765 | Open in IMG/M |
| 3300005545|Ga0070695_101610298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 542 | Open in IMG/M |
| 3300005546|Ga0070696_101533951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300005549|Ga0070704_101933477 | Not Available | 547 | Open in IMG/M |
| 3300005576|Ga0066708_10704981 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005617|Ga0068859_103146605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 503 | Open in IMG/M |
| 3300005618|Ga0068864_100032498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4434 | Open in IMG/M |
| 3300005713|Ga0066905_100013455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4038 | Open in IMG/M |
| 3300005713|Ga0066905_100486519 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300005713|Ga0066905_102055788 | Not Available | 531 | Open in IMG/M |
| 3300005764|Ga0066903_102936863 | Not Available | 924 | Open in IMG/M |
| 3300005842|Ga0068858_101351605 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300006046|Ga0066652_101158071 | Not Available | 732 | Open in IMG/M |
| 3300006163|Ga0070715_10728699 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006574|Ga0074056_10004011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1304 | Open in IMG/M |
| 3300006574|Ga0074056_11736480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 742 | Open in IMG/M |
| 3300006577|Ga0074050_12049499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
| 3300006605|Ga0074057_11997721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300006797|Ga0066659_10210442 | Not Available | 1430 | Open in IMG/M |
| 3300006844|Ga0075428_100004106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16026 | Open in IMG/M |
| 3300006844|Ga0075428_100101225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3141 | Open in IMG/M |
| 3300006844|Ga0075428_100670543 | Not Available | 1105 | Open in IMG/M |
| 3300006844|Ga0075428_101008011 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300006845|Ga0075421_100012234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10654 | Open in IMG/M |
| 3300006845|Ga0075421_101790826 | Not Available | 661 | Open in IMG/M |
| 3300006845|Ga0075421_101944729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300006846|Ga0075430_100115440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2237 | Open in IMG/M |
| 3300006846|Ga0075430_100436382 | Not Available | 1081 | Open in IMG/M |
| 3300006853|Ga0075420_100306595 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300006854|Ga0075425_101383306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 797 | Open in IMG/M |
| 3300006871|Ga0075434_100602297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
| 3300006871|Ga0075434_101937873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus | 595 | Open in IMG/M |
| 3300006871|Ga0075434_102064378 | Not Available | 575 | Open in IMG/M |
| 3300006876|Ga0079217_10001464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6398 | Open in IMG/M |
| 3300006876|Ga0079217_10047939 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300006876|Ga0079217_10258031 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300006876|Ga0079217_10273337 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300006876|Ga0079217_10549915 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300006876|Ga0079217_10615250 | Not Available | 709 | Open in IMG/M |
| 3300006880|Ga0075429_101043220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 714 | Open in IMG/M |
| 3300006894|Ga0079215_10231654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 963 | Open in IMG/M |
| 3300006894|Ga0079215_10337644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 854 | Open in IMG/M |
| 3300006894|Ga0079215_10361062 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300006894|Ga0079215_10563037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 731 | Open in IMG/M |
| 3300006894|Ga0079215_10569690 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300006894|Ga0079215_10960566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 622 | Open in IMG/M |
| 3300006918|Ga0079216_10504148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 800 | Open in IMG/M |
| 3300006918|Ga0079216_11195953 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006969|Ga0075419_10154534 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300007004|Ga0079218_10015965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3919 | Open in IMG/M |
| 3300007004|Ga0079218_10115852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1879 | Open in IMG/M |
| 3300007004|Ga0079218_10533920 | Not Available | 1049 | Open in IMG/M |
| 3300007004|Ga0079218_10929260 | Not Available | 859 | Open in IMG/M |
| 3300007004|Ga0079218_12452229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 615 | Open in IMG/M |
| 3300007004|Ga0079218_12639194 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300007004|Ga0079218_12723573 | Not Available | 590 | Open in IMG/M |
| 3300007076|Ga0075435_101225520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus | 657 | Open in IMG/M |
| 3300007076|Ga0075435_101665890 | Not Available | 560 | Open in IMG/M |
| 3300007265|Ga0099794_10003056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6319 | Open in IMG/M |
| 3300009053|Ga0105095_10118557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1439 | Open in IMG/M |
| 3300009053|Ga0105095_10478455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 690 | Open in IMG/M |
| 3300009078|Ga0105106_10027506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4199 | Open in IMG/M |
| 3300009078|Ga0105106_10505887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 868 | Open in IMG/M |
| 3300009078|Ga0105106_11215390 | Not Available | 535 | Open in IMG/M |
| 3300009078|Ga0105106_11329486 | Not Available | 510 | Open in IMG/M |
| 3300009087|Ga0105107_10087819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 2190 | Open in IMG/M |
| 3300009087|Ga0105107_10183194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1469 | Open in IMG/M |
| 3300009088|Ga0099830_10492106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 999 | Open in IMG/M |
| 3300009089|Ga0099828_10407640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1226 | Open in IMG/M |
| 3300009089|Ga0099828_11275146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus | 650 | Open in IMG/M |
| 3300009094|Ga0111539_10014798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9730 | Open in IMG/M |
| 3300009094|Ga0111539_10803359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1095 | Open in IMG/M |
| 3300009095|Ga0079224_100097143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4268 | Open in IMG/M |
| 3300009098|Ga0105245_10963364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300009100|Ga0075418_11217116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
| 3300009100|Ga0075418_12262056 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009137|Ga0066709_100379935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1952 | Open in IMG/M |
| 3300009147|Ga0114129_10160203 | All Organisms → cellular organisms → Bacteria | 3075 | Open in IMG/M |
| 3300009147|Ga0114129_10873245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1142 | Open in IMG/M |
| 3300009147|Ga0114129_11116816 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300009153|Ga0105094_10504026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 704 | Open in IMG/M |
| 3300009156|Ga0111538_12127750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
| 3300009162|Ga0075423_10323758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1616 | Open in IMG/M |
| 3300009166|Ga0105100_10670497 | Not Available | 638 | Open in IMG/M |
| 3300009171|Ga0105101_10012674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4013 | Open in IMG/M |
| 3300009597|Ga0105259_1028925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1186 | Open in IMG/M |
| 3300009597|Ga0105259_1134628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 597 | Open in IMG/M |
| 3300009609|Ga0105347_1023879 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300009609|Ga0105347_1539343 | Not Available | 508 | Open in IMG/M |
| 3300009610|Ga0105340_1000449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 19927 | Open in IMG/M |
| 3300009678|Ga0105252_10024872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2164 | Open in IMG/M |
| 3300010039|Ga0126309_11293633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 505 | Open in IMG/M |
| 3300010045|Ga0126311_11177605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 633 | Open in IMG/M |
| 3300010047|Ga0126382_10474198 | Not Available | 998 | Open in IMG/M |
| 3300010333|Ga0134080_10436974 | Not Available | 611 | Open in IMG/M |
| 3300010362|Ga0126377_10746518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1034 | Open in IMG/M |
| 3300010362|Ga0126377_11067063 | Not Available | 876 | Open in IMG/M |
| 3300010371|Ga0134125_11124617 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300010399|Ga0134127_10267161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1630 | Open in IMG/M |
| 3300010399|Ga0134127_10287963 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius | 1576 | Open in IMG/M |
| 3300010399|Ga0134127_11001045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 896 | Open in IMG/M |
| 3300010399|Ga0134127_11076531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 867 | Open in IMG/M |
| 3300010399|Ga0134127_11102170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 858 | Open in IMG/M |
| 3300010399|Ga0134127_11462059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 755 | Open in IMG/M |
| 3300010399|Ga0134127_12232596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus | 626 | Open in IMG/M |
| 3300010400|Ga0134122_10253409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1488 | Open in IMG/M |
| 3300010401|Ga0134121_10222226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1641 | Open in IMG/M |
| 3300010403|Ga0134123_10104378 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300010403|Ga0134123_11774000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 670 | Open in IMG/M |
| 3300011269|Ga0137392_10370593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 1187 | Open in IMG/M |
| 3300011333|Ga0127502_10234354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 710 | Open in IMG/M |
| 3300011398|Ga0137348_1020826 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300011399|Ga0137466_1013287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 1021 | Open in IMG/M |
| 3300011402|Ga0137356_1019550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1218 | Open in IMG/M |
| 3300011403|Ga0137313_1013312 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300011405|Ga0137340_1010998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1627 | Open in IMG/M |
| 3300011413|Ga0137333_1043085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 1020 | Open in IMG/M |
| 3300011415|Ga0137325_1002389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4057 | Open in IMG/M |
| 3300011417|Ga0137326_1006820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2667 | Open in IMG/M |
| 3300011430|Ga0137423_1005244 | All Organisms → cellular organisms → Bacteria | 4118 | Open in IMG/M |
| 3300011432|Ga0137428_1018538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13 | 1747 | Open in IMG/M |
| 3300011432|Ga0137428_1021051 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300011434|Ga0137464_1016584 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
| 3300011434|Ga0137464_1040207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1293 | Open in IMG/M |
| 3300011438|Ga0137451_1147472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 735 | Open in IMG/M |
| 3300011438|Ga0137451_1281579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 522 | Open in IMG/M |
| 3300011439|Ga0137432_1100953 | Not Available | 904 | Open in IMG/M |
| 3300011442|Ga0137437_1081266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 1107 | Open in IMG/M |
| 3300011444|Ga0137463_1021939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2292 | Open in IMG/M |
| 3300011445|Ga0137427_10048181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1683 | Open in IMG/M |
| 3300011445|Ga0137427_10062012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1483 | Open in IMG/M |
| 3300011993|Ga0120182_1006545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 765 | Open in IMG/M |
| 3300012034|Ga0137453_1030303 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300012039|Ga0137421_1249371 | Not Available | 514 | Open in IMG/M |
| 3300012122|Ga0137332_1036325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 576 | Open in IMG/M |
| 3300012159|Ga0137344_1009388 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300012161|Ga0137336_1015964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1314 | Open in IMG/M |
| 3300012163|Ga0137355_1033368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 950 | Open in IMG/M |
| 3300012167|Ga0137319_1040357 | Not Available | 934 | Open in IMG/M |
| 3300012189|Ga0137388_10925462 | Not Available | 806 | Open in IMG/M |
| 3300012189|Ga0137388_11255341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 679 | Open in IMG/M |
| 3300012204|Ga0137374_10031120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 5833 | Open in IMG/M |
| 3300012206|Ga0137380_10427700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 1173 | Open in IMG/M |
| 3300012212|Ga0150985_106013023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1374 | Open in IMG/M |
| 3300012232|Ga0137435_1040754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1356 | Open in IMG/M |
| 3300012469|Ga0150984_103002690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus | 555 | Open in IMG/M |
| 3300012469|Ga0150984_112057625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 961 | Open in IMG/M |
| 3300012469|Ga0150984_116218916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 537 | Open in IMG/M |
| 3300012685|Ga0137397_10084716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2310 | Open in IMG/M |
| 3300012897|Ga0157285_10054516 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300012905|Ga0157296_10055680 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300012907|Ga0157283_10072858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300012908|Ga0157286_10176465 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300012910|Ga0157308_10021185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1462 | Open in IMG/M |
| 3300012922|Ga0137394_10234341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1569 | Open in IMG/M |
| 3300012944|Ga0137410_10000360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 31942 | Open in IMG/M |
| 3300012958|Ga0164299_10844452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300012960|Ga0164301_10588594 | Not Available | 819 | Open in IMG/M |
| 3300012971|Ga0126369_12437786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300013100|Ga0157373_10738474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
| 3300013297|Ga0157378_12557265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300013307|Ga0157372_11380640 | Not Available | 812 | Open in IMG/M |
| 3300014308|Ga0075354_1003912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 1884 | Open in IMG/M |
| 3300014864|Ga0180068_1070281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 584 | Open in IMG/M |
| 3300014868|Ga0180088_1078283 | Not Available | 593 | Open in IMG/M |
| 3300014871|Ga0180095_1084156 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300014872|Ga0180087_1101385 | Not Available | 552 | Open in IMG/M |
| 3300014879|Ga0180062_1114351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 618 | Open in IMG/M |
| 3300014968|Ga0157379_12151833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 553 | Open in IMG/M |
| 3300015084|Ga0167654_1047281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300015170|Ga0120098_1058208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
| 3300015200|Ga0173480_10911710 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300015245|Ga0137409_10452467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1104 | Open in IMG/M |
| 3300015371|Ga0132258_10388799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3462 | Open in IMG/M |
| 3300015371|Ga0132258_11046630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2063 | Open in IMG/M |
| 3300015372|Ga0132256_100078232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3155 | Open in IMG/M |
| 3300018027|Ga0184605_10064814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1573 | Open in IMG/M |
| 3300018027|Ga0184605_10128132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1133 | Open in IMG/M |
| 3300018028|Ga0184608_10475948 | Not Available | 536 | Open in IMG/M |
| 3300018056|Ga0184623_10195064 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300018422|Ga0190265_10014009 | All Organisms → cellular organisms → Bacteria | 6164 | Open in IMG/M |
| 3300018422|Ga0190265_10023448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4977 | Open in IMG/M |
| 3300018422|Ga0190265_10023609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4962 | Open in IMG/M |
| 3300018422|Ga0190265_10037354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4106 | Open in IMG/M |
| 3300018422|Ga0190265_10163089 | All Organisms → cellular organisms → Bacteria | 2197 | Open in IMG/M |
| 3300018422|Ga0190265_10337765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1589 | Open in IMG/M |
| 3300018422|Ga0190265_10469732 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300018422|Ga0190265_10863846 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300018422|Ga0190265_13773185 | Not Available | 505 | Open in IMG/M |
| 3300018429|Ga0190272_10004319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6769 | Open in IMG/M |
| 3300018429|Ga0190272_10016394 | All Organisms → cellular organisms → Bacteria | 3755 | Open in IMG/M |
| 3300018429|Ga0190272_10596518 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300018429|Ga0190272_11480655 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300018429|Ga0190272_11725580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 649 | Open in IMG/M |
| 3300018429|Ga0190272_11836835 | Not Available | 634 | Open in IMG/M |
| 3300018429|Ga0190272_12539769 | Not Available | 559 | Open in IMG/M |
| 3300018432|Ga0190275_10359233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1452 | Open in IMG/M |
| 3300018432|Ga0190275_10533301 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300018465|Ga0190269_11028407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 626 | Open in IMG/M |
| 3300018466|Ga0190268_11406636 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300018466|Ga0190268_11873140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 544 | Open in IMG/M |
| 3300018468|Ga0066662_12673113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 528 | Open in IMG/M |
| 3300018469|Ga0190270_10402187 | Not Available | 1268 | Open in IMG/M |
| 3300018469|Ga0190270_11514309 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300018476|Ga0190274_10406986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1322 | Open in IMG/M |
| 3300019208|Ga0180110_1036762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 592 | Open in IMG/M |
| 3300019257|Ga0180115_1344283 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300019361|Ga0173482_10738347 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300019377|Ga0190264_10028247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2001 | Open in IMG/M |
| 3300019377|Ga0190264_10254254 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300019377|Ga0190264_10556903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 804 | Open in IMG/M |
| 3300019377|Ga0190264_11219303 | Not Available | 627 | Open in IMG/M |
| 3300019458|Ga0187892_10006495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17298 | Open in IMG/M |
| 3300019884|Ga0193741_1017296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13 | 1857 | Open in IMG/M |
| 3300020066|Ga0180108_1229125 | Not Available | 511 | Open in IMG/M |
| 3300020146|Ga0196977_1113628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 624 | Open in IMG/M |
| 3300020147|Ga0196976_1024954 | Not Available | 1360 | Open in IMG/M |
| 3300020202|Ga0196964_10013727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3365 | Open in IMG/M |
| 3300020202|Ga0196964_10034518 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
| 3300020202|Ga0196964_10235485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 855 | Open in IMG/M |
| 3300020202|Ga0196964_10281257 | Not Available | 785 | Open in IMG/M |
| 3300020202|Ga0196964_10338934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 717 | Open in IMG/M |
| 3300020202|Ga0196964_10473561 | Not Available | 610 | Open in IMG/M |
| 3300020215|Ga0196963_10023494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2642 | Open in IMG/M |
| 3300020215|Ga0196963_10150509 | Not Available | 994 | Open in IMG/M |
| 3300020215|Ga0196963_10217361 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300021057|Ga0196981_1045897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300021066|Ga0196980_1012209 | Not Available | 1314 | Open in IMG/M |
| 3300021066|Ga0196980_1052514 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300021082|Ga0210380_10266789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300022756|Ga0222622_11335133 | Not Available | 528 | Open in IMG/M |
| 3300023102|Ga0247754_1133986 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300024177|Ga0247686_1000644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4706 | Open in IMG/M |
| 3300024177|Ga0247686_1052615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300024317|Ga0247660_1012541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1303 | Open in IMG/M |
| 3300024430|Ga0196962_10262073 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300025155|Ga0209320_10030528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2603 | Open in IMG/M |
| 3300025167|Ga0209642_10173121 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300025893|Ga0207682_10302632 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300025901|Ga0207688_10105397 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
| 3300025917|Ga0207660_10094893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2218 | Open in IMG/M |
| 3300025917|Ga0207660_10333664 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300025918|Ga0207662_10039769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2760 | Open in IMG/M |
| 3300025923|Ga0207681_10362452 | Not Available | 1163 | Open in IMG/M |
| 3300025930|Ga0207701_11000399 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300025949|Ga0207667_10725581 | Not Available | 995 | Open in IMG/M |
| 3300025960|Ga0207651_11592772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus | 588 | Open in IMG/M |
| 3300026075|Ga0207708_10234406 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300026088|Ga0207641_10448772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1246 | Open in IMG/M |
| 3300026088|Ga0207641_11164844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 770 | Open in IMG/M |
| 3300026118|Ga0207675_100716147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
| 3300026300|Ga0209027_1255198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14 | 562 | Open in IMG/M |
| 3300026342|Ga0209057_1212272 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300027533|Ga0208185_1001297 | All Organisms → cellular organisms → Bacteria | 7329 | Open in IMG/M |
| 3300027543|Ga0209999_1060454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 721 | Open in IMG/M |
| 3300027573|Ga0208454_1006910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3049 | Open in IMG/M |
| 3300027637|Ga0209818_1004797 | All Organisms → cellular organisms → Bacteria | 2614 | Open in IMG/M |
| 3300027637|Ga0209818_1034067 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300027637|Ga0209818_1128165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 695 | Open in IMG/M |
| 3300027639|Ga0209387_1101029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 707 | Open in IMG/M |
| 3300027639|Ga0209387_1166545 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300027639|Ga0209387_1218068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 531 | Open in IMG/M |
| 3300027664|Ga0207873_1129184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300027695|Ga0209966_1001941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3467 | Open in IMG/M |
| 3300027695|Ga0209966_1008012 | All Organisms → cellular organisms → Bacteria | 1865 | Open in IMG/M |
| 3300027713|Ga0209286_1073214 | Not Available | 1282 | Open in IMG/M |
| 3300027723|Ga0209703_1026158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13 | 2229 | Open in IMG/M |
| 3300027778|Ga0209464_10069233 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300027818|Ga0209706_10108994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 1376 | Open in IMG/M |
| 3300027821|Ga0209811_10008845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3238 | Open in IMG/M |
| 3300027821|Ga0209811_10223931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 714 | Open in IMG/M |
| 3300027873|Ga0209814_10228601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 805 | Open in IMG/M |
| 3300027873|Ga0209814_10322586 | Not Available | 674 | Open in IMG/M |
| 3300027880|Ga0209481_10001551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9315 | Open in IMG/M |
| 3300027880|Ga0209481_10284015 | Not Available | 838 | Open in IMG/M |
| 3300027880|Ga0209481_10770044 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300027886|Ga0209486_10040016 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
| 3300027886|Ga0209486_10252935 | Not Available | 1019 | Open in IMG/M |
| 3300027886|Ga0209486_10510841 | Not Available | 748 | Open in IMG/M |
| 3300027886|Ga0209486_10517006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 744 | Open in IMG/M |
| 3300027907|Ga0207428_10038497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3887 | Open in IMG/M |
| 3300027909|Ga0209382_11936436 | Not Available | 568 | Open in IMG/M |
| 3300027909|Ga0209382_12053793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 546 | Open in IMG/M |
| 3300027979|Ga0209705_10241667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 935 | Open in IMG/M |
| 3300027979|Ga0209705_10565808 | Not Available | 547 | Open in IMG/M |
| 3300028380|Ga0268265_10151526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1956 | Open in IMG/M |
| 3300028381|Ga0268264_10066470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3040 | Open in IMG/M |
| 3300028381|Ga0268264_11692047 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300028592|Ga0247822_10166186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1633 | Open in IMG/M |
| 3300028592|Ga0247822_10288677 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300028809|Ga0247824_10017229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3839 | Open in IMG/M |
| 3300028809|Ga0247824_10073963 | Not Available | 1772 | Open in IMG/M |
| 3300028812|Ga0247825_10018376 | All Organisms → cellular organisms → Bacteria | 4565 | Open in IMG/M |
| 3300028812|Ga0247825_10081363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2178 | Open in IMG/M |
| 3300028812|Ga0247825_10331946 | Not Available | 1066 | Open in IMG/M |
| 3300028812|Ga0247825_10490860 | Not Available | 873 | Open in IMG/M |
| 3300028812|Ga0247825_11390944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 514 | Open in IMG/M |
| 3300030006|Ga0299907_10006147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8187 | Open in IMG/M |
| 3300030006|Ga0299907_11105270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 575 | Open in IMG/M |
| 3300030619|Ga0268386_10956662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 531 | Open in IMG/M |
| 3300031229|Ga0299913_10059405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3669 | Open in IMG/M |
| 3300031547|Ga0310887_10106770 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300031547|Ga0310887_10944631 | Not Available | 548 | Open in IMG/M |
| 3300031548|Ga0307408_100229133 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300031548|Ga0307408_100625935 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300031548|Ga0307408_101581979 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031562|Ga0310886_10264283 | Not Available | 969 | Open in IMG/M |
| 3300031720|Ga0307469_12291995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300031731|Ga0307405_10897327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 749 | Open in IMG/M |
| 3300031731|Ga0307405_11502876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 592 | Open in IMG/M |
| 3300031731|Ga0307405_11650464 | Not Available | 567 | Open in IMG/M |
| 3300031740|Ga0307468_100179203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 1404 | Open in IMG/M |
| 3300031740|Ga0307468_100206219 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300031740|Ga0307468_100657638 | Not Available | 867 | Open in IMG/M |
| 3300031740|Ga0307468_101299001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300031740|Ga0307468_101838656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 575 | Open in IMG/M |
| 3300031740|Ga0307468_102159001 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300031820|Ga0307473_10481018 | Not Available | 834 | Open in IMG/M |
| 3300031824|Ga0307413_11265656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 644 | Open in IMG/M |
| 3300031852|Ga0307410_10447549 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300031854|Ga0310904_10573951 | Not Available | 766 | Open in IMG/M |
| 3300031901|Ga0307406_10686345 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031911|Ga0307412_11744572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 571 | Open in IMG/M |
| 3300031943|Ga0310885_10643450 | Not Available | 591 | Open in IMG/M |
| 3300031944|Ga0310884_10905156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300032000|Ga0310903_10847053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300032002|Ga0307416_100259965 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300032002|Ga0307416_102990483 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300032005|Ga0307411_10187399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1576 | Open in IMG/M |
| 3300032005|Ga0307411_10242517 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300032005|Ga0307411_10822013 | Not Available | 820 | Open in IMG/M |
| 3300032005|Ga0307411_11681326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 587 | Open in IMG/M |
| 3300032013|Ga0310906_10018423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2915 | Open in IMG/M |
| 3300032013|Ga0310906_11022100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300032017|Ga0310899_10082482 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300032017|Ga0310899_10686052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300032126|Ga0307415_101562893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 633 | Open in IMG/M |
| 3300032144|Ga0315910_10017370 | All Organisms → cellular organisms → Bacteria | 5393 | Open in IMG/M |
| 3300032144|Ga0315910_10030802 | All Organisms → cellular organisms → Bacteria | 3934 | Open in IMG/M |
| 3300032144|Ga0315910_10095906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2175 | Open in IMG/M |
| 3300032157|Ga0315912_11068978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 640 | Open in IMG/M |
| 3300032174|Ga0307470_10671357 | Not Available | 785 | Open in IMG/M |
| 3300032174|Ga0307470_11314890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus | 593 | Open in IMG/M |
| 3300032180|Ga0307471_101502488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 832 | Open in IMG/M |
| 3300032180|Ga0307471_102835127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus | 615 | Open in IMG/M |
| 3300032180|Ga0307471_102946547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 604 | Open in IMG/M |
| 3300032205|Ga0307472_100239632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 1413 | Open in IMG/M |
| 3300032205|Ga0307472_100614687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus | 962 | Open in IMG/M |
| 3300032770|Ga0335085_10020296 | All Organisms → cellular organisms → Bacteria | 9497 | Open in IMG/M |
| 3300033407|Ga0214472_10767255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 871 | Open in IMG/M |
| 3300033412|Ga0310810_10574380 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300033550|Ga0247829_11168527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 638 | Open in IMG/M |
| 3300033551|Ga0247830_10986044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 672 | Open in IMG/M |
| 3300034149|Ga0364929_0110800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 871 | Open in IMG/M |
| 3300034150|Ga0364933_037843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1183 | Open in IMG/M |
| 3300034151|Ga0364935_0168533 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300034164|Ga0364940_0267976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300034354|Ga0364943_0008951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2963 | Open in IMG/M |
| 3300034819|Ga0373958_0042189 | Not Available | 937 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.14% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 10.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 7.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.33% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.12% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.15% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.15% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.63% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 3.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.21% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.21% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.73% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.73% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.73% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.73% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.48% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.24% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.24% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.24% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.24% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.24% |
| Fossill | Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill | 0.24% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.24% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.24% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.24% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.24% |
| Feedstock Adapted Compost | Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost | 0.24% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011399 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2 | Environmental | Open in IMG/M |
| 3300011402 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2 | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300011993 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012122 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT200_2 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012161 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2 | Environmental | Open in IMG/M |
| 3300012163 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2 | Environmental | Open in IMG/M |
| 3300012167 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014864 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D | Environmental | Open in IMG/M |
| 3300014868 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D | Environmental | Open in IMG/M |
| 3300014871 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015084 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015170 | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020066 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
| 3300020147 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021057 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_20-13C | Environmental | Open in IMG/M |
| 3300021066 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_10-13C | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027664 | Cellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - BGW Initial Compost (SPAdes) | Engineered | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_00152630 | 2088090015 | Soil | MEGAGWLIVFVALFVVGLAGLFLYGWLRRKEKPPPGVKPLPDDDDDWGR |
| JGI10216J12902_1002175472 | 3300000956 | Soil | MGDSGFILFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| C688J18823_101865332 | 3300001686 | Soil | RSNDASRAPGMSGSWLIILVGAFVAGLIGLFFYGWLRRKDKPPPGVKPLKDDDDW* |
| C688J18823_102441652 | 3300001686 | Soil | MSGSWLIILVGAFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW* |
| soilL2_100102727 | 3300003319 | Sugarcane Root And Bulk Soil | VNGTVWLIVFVGAFVAGLAGLFLYGWLRRKEKPPPGVKPLADDDDWK* |
| soilL2_100694391 | 3300003319 | Sugarcane Root And Bulk Soil | LQNGLIWLVVFLALALAGLLGMFLYGWRRRKEAPPPGVKPLRDDDDDWGR* |
| soilH2_101101593 | 3300003324 | Sugarcane Root And Bulk Soil | MGDASFIIFLGLALAALGGLFLYGWARRKEKPPPGVKPLKDEDWD* |
| Ga0055432_100065452 | 3300004022 | Natural And Restored Wetlands | VSEIWLAVFLGAFVVGLGGLFLYGWLRRKEKPPPGVKPIKDDDDDW* |
| Ga0062593_1010196313 | 3300004114 | Soil | VTEDWFIVFTGFAVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDDWGR* |
| Ga0062593_1014879642 | 3300004114 | Soil | MGDNGFLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK* |
| Ga0062589_1009476912 | 3300004156 | Soil | VNGGWLIVFVGAFVAALAGLFLYGWLRRKEKPPPGVKPLKDDDW* |
| Ga0062589_1018388932 | 3300004156 | Soil | MSGGWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0062590_1000653343 | 3300004157 | Soil | VSGNWLIILVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0062590_1024709711 | 3300004157 | Soil | MGDNGWLVFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0063356_1000102192 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSESTLWLIIFLVLAVGGLAGLFLFGWRRRKEKPPPGVKPLPPDDDWK* |
| Ga0063356_1001319002 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MEGAGWLIVFVALFVVGLAGLFLYGWLRRKEKPPPGVKPLPDDDDDWGR* |
| Ga0063356_1001371544 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MGDSFFTVFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0063356_1001908864 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VSETWFIVFIGIALAGLAGLFLYGWRRRREKPPPGVKPLTDKDDEDWRR* |
| Ga0063356_1002424453 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VDWLPALIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDWD* |
| Ga0063356_1003961411 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MVDSGWIILIGGLIAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDDWGR* |
| Ga0063356_1009108282 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSESTLWLVIFLVLAVGGLAGMFLFGWLRRKEKPPPGVKPLPPEDDWK* |
| Ga0063356_1009262952 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VNGGWLLVFVAAFVAGLIGLFLYGWLRRREKPPPGVKPLPPDDD* |
| Ga0063356_1011222742 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VGVALAGLGGLFLYGWRRRKEEPPPGVKPLKDDDDDWGR* |
| Ga0062592_1016934692 | 3300004480 | Soil | MGDSGFILFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKD |
| Ga0062382_102751802 | 3300004782 | Wetland Sediment | MGDNGFIVFVGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0058859_113207202 | 3300004798 | Host-Associated | VSGGWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0062594_1001084403 | 3300005093 | Soil | VSGGWLIVFVGAFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0062594_1025142832 | 3300005093 | Soil | VNGGWLIALVGLFVLGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0065705_100498643 | 3300005294 | Switchgrass Rhizosphere | MGDSGFILFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0065705_103740902 | 3300005294 | Switchgrass Rhizosphere | VSGGWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0065705_107035562 | 3300005294 | Switchgrass Rhizosphere | VNGGWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0070676_107322763 | 3300005328 | Miscanthus Rhizosphere | MGDSGFLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK* |
| Ga0070690_1005231472 | 3300005330 | Switchgrass Rhizosphere | QVSGNWLIILVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0070690_1006743141 | 3300005330 | Switchgrass Rhizosphere | SGFLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0066388_1001650193 | 3300005332 | Tropical Forest Soil | VSGTWLIVFVGAFVAGLIGLFLYGWLRRKEKPPPGIKPLKDDDDW* |
| Ga0066388_1020090682 | 3300005332 | Tropical Forest Soil | VSGGWLIVFVGVFVAGLAGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0066388_1038464252 | 3300005332 | Tropical Forest Soil | MSGGGWLIVFVGVFVAGLVCLFLYGWLRRKEKPPPGVKPLKDEDDW* |
| Ga0070680_1002493302 | 3300005336 | Corn Rhizosphere | LPLESTLLWFIVFVGVALAGLIGLFLYGWRRRQEPPPPGVKPLKDDEDDWGR* |
| Ga0070680_1003834002 | 3300005336 | Corn Rhizosphere | MGDNGWLVFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK* |
| Ga0068868_1005869951 | 3300005338 | Miscanthus Rhizosphere | MGDNGWLVFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLK |
| Ga0070691_109446601 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | SRHSPMGDNGWLVFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0070703_104638772 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEDWFIVFTGFAVAGMIGLFLYGWLRRKEKPPPGVKPLKDDDDDWGR* |
| Ga0070701_107240972 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDSGFLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKD |
| Ga0070705_1000216063 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VIETWFLAFIGVAIAGLVGLFLYGWGRRKEKPPPGVKPLKDEDDWK* |
| Ga0070694_1000069387 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VIETWFLAFIGVAVAGLVGLFLYGWGRRKEKPPPGVKPLKDEDDWK* |
| Ga0070694_1004575152 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VNGGWLIVFVGVFVAGLAGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0070694_1006310202 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLVLAVGGLAGMFLYGWRRRKERPPPGVKPLSREEDWR* |
| Ga0070694_1007767521 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDNGWLVFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDD |
| Ga0066686_104820772 | 3300005446 | Soil | MSASYWLIIYLVLAISGLVGIFLFGWKRRREKPPPGVKPLPPDDDDWK* |
| Ga0066682_104045072 | 3300005450 | Soil | VSGNWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDEDDW* |
| Ga0070663_1002447353 | 3300005455 | Corn Rhizosphere | MGDSGFLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0073909_102079672 | 3300005526 | Surface Soil | VSSTWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0073909_102678961 | 3300005526 | Surface Soil | ATAANARPAMSGSSLWLIIFLVLAVGGLLGMFLFGWRRRKEKPPPGVKPLPPDDDWK* |
| Ga0070695_1016102981 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LESTLLWFIVFVGVALAGLIGLFLYGWRRRQEPPPPGVKPLKDDEDDWGR* |
| Ga0070696_1015339511 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | SAHAAAATTRPAMSESTLWLIMFLVLAVGGLAGMFLYGWRRRKERPPPGVKPLSREEDWR |
| Ga0070704_1019334771 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VNGGWLIVFVGAFVAALAGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0066708_107049812 | 3300005576 | Soil | MSASYWLIIFLVLAIGGLVGIFLFGWKRRREKPPPGVKPLPPDDDDWK* |
| Ga0068859_1031466053 | 3300005617 | Switchgrass Rhizosphere | FLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK* |
| Ga0068864_1000324984 | 3300005618 | Switchgrass Rhizosphere | VGGGWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0066905_1000134555 | 3300005713 | Tropical Forest Soil | VSGTWLIVFVGAFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0066905_1004865192 | 3300005713 | Tropical Forest Soil | MNETWFIVFIGVALAGLIGLFLYGWVRRKEKPPPGVKPLKDDDDDWGR* |
| Ga0066905_1020557881 | 3300005713 | Tropical Forest Soil | LENAAPWFIIFIGVAVAGLVGLFLYGWLRRKEKPPPGVKPLKDEEEDW* |
| Ga0066903_1029368631 | 3300005764 | Tropical Forest Soil | MSAGWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0068858_1013516052 | 3300005842 | Switchgrass Rhizosphere | MGDNGWLVFIGLAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0066656_101420912 | 3300006034 | Soil | LLAVGGLVGIFLYGWRRRKEKPPKVAPLPKDDDWD* |
| Ga0066652_1011580711 | 3300006046 | Soil | FVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDWGR* |
| Ga0070715_107286991 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | CRSNKRPGQVSGGWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0074056_100040113 | 3300006574 | Soil | MNGGWLIVFVGAFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW |
| Ga0074056_117364802 | 3300006574 | Soil | MSGNWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0074050_120494992 | 3300006577 | Soil | MNGGWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0074057_119977212 | 3300006605 | Soil | VSGNWLIIFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0066659_102104423 | 3300006797 | Soil | MSGNWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDEDDW* |
| Ga0075428_1000041068 | 3300006844 | Populus Rhizosphere | VSGGWLIALVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDDW* |
| Ga0075428_1001012256 | 3300006844 | Populus Rhizosphere | MGDNGWLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDDWGKS* |
| Ga0075428_1006705431 | 3300006844 | Populus Rhizosphere | LQDSAPGLEDSLIWLVLFLGVALAGLGGMFLYGWMRRKEAPPPGVKPLKDDDDWGR* |
| Ga0075428_1010080112 | 3300006844 | Populus Rhizosphere | MAGNGLLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDWGKS* |
| Ga0075421_10001223415 | 3300006845 | Populus Rhizosphere | LETATPWFIIFIGVALAGLIGLFLYGWLRRKEKPPPGVKPLKDEEDW* |
| Ga0075421_1017908262 | 3300006845 | Populus Rhizosphere | MSATWLAIFVGAFVAGLVGLFLYGWLRRKEKPPPGVKPLKDDEDDW* |
| Ga0075421_1019447291 | 3300006845 | Populus Rhizosphere | VLAVGGLAGMFLFGWLRRKEKPPPGVKPLPPEDDWK* |
| Ga0075430_1001154401 | 3300006846 | Populus Rhizosphere | LIWLVLFLGLALAGLGGMFLYGWRRRKEKPPPGVKPLPEEDDWK* |
| Ga0075430_1004363822 | 3300006846 | Populus Rhizosphere | VSGGGGWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDEDD* |
| Ga0075420_1003065952 | 3300006853 | Populus Rhizosphere | MDDSLFIVFIGAAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0075425_1013833062 | 3300006854 | Populus Rhizosphere | VQVSGGWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0075434_1006022972 | 3300006871 | Populus Rhizosphere | MSESNLWLIIFLVLAVGGLAGMFLFGWRRRKEKPPPGVKPLPPDDDWK* |
| Ga0075434_1019378731 | 3300006871 | Populus Rhizosphere | SAAMNESTLWLVIFLVLAVGGLVGMFLFGWKRRKEKPPPGVKPLPPDDDW* |
| Ga0075434_1020643781 | 3300006871 | Populus Rhizosphere | VNGGWLIALVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0079217_100014648 | 3300006876 | Agricultural Soil | MDAAWLIVFVGAFIAGLAGLFLYGWLRRKEKPPPGVKPLPDNDDWDR* |
| Ga0079217_100479393 | 3300006876 | Agricultural Soil | VTDDWFIVFTGVAVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDDWGR* |
| Ga0079217_102580312 | 3300006876 | Agricultural Soil | LENALIWLVVFLGLAFAGLGGLFLYGWLRRKEKPPPGVKPLPPEDDDWGR* |
| Ga0079217_102733372 | 3300006876 | Agricultural Soil | MSGGGWLIVFLGLAIAGLAGLFLYGWLRRKEKPPPGVKPLPPDDDDWRR* |
| Ga0079217_105499152 | 3300006876 | Agricultural Soil | VSESWLIVFVGLFVAGLAGLFLYGWLRRKEKPPPGVKPLKDEDDWK* |
| Ga0079217_106152501 | 3300006876 | Agricultural Soil | LMEGGWLIAFVAAFIAGLAGLFLYGWLRRKEKPPPGVKPLPDDDDDWGR* |
| Ga0075429_1010432203 | 3300006880 | Populus Rhizosphere | IAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDDWGKS* |
| Ga0079215_102316542 | 3300006894 | Agricultural Soil | VTENWFIIFIGVALAGLIGLFLYGWARRKEKPPPGVKPLKDEDDWK* |
| Ga0079215_103376443 | 3300006894 | Agricultural Soil | LEPTLYIVFIGVALAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDWDR* |
| Ga0079215_103610623 | 3300006894 | Agricultural Soil | LENALIWLVVFLGLAFAGLGGLFLYGWLRRKEKPPPGVKPLPPEDDWK* |
| Ga0079215_105630371 | 3300006894 | Agricultural Soil | LESTLLWFIVFIGLALAGWIGLFLYGWRRRKEKPPPGVKPLTDADDEKWK* |
| Ga0079215_105696902 | 3300006894 | Agricultural Soil | MSGGSWLIVFLGLAIAGLAGLFLYGWLRRKEKPPPGVKPLPPDDDDWRR* |
| Ga0079215_109605661 | 3300006894 | Agricultural Soil | VTDDWFIVFTGVAVAGLIGLFLYGWLRRKEKPPPGVKLKDDDDDWGR* |
| Ga0079216_105041481 | 3300006918 | Agricultural Soil | HRRRKTDGTRSQVIETWFLVFIGGALAGLVGLFLYGWSRRKEKPPPGVKPLKDDDDDWR* |
| Ga0079216_111959532 | 3300006918 | Agricultural Soil | LENALIWLVVFLGLALAGLGGLFLYGWLRRKDKPPPGVKPLPPEDDDWGR* |
| Ga0075419_101545344 | 3300006969 | Populus Rhizosphere | LIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDWGKS* |
| Ga0079218_100159652 | 3300007004 | Agricultural Soil | LEDSLIWLVVFLGVALAGLGGMFLYGWLRRKEAPPPGVKPLKDDDHDWGR* |
| Ga0079218_101158523 | 3300007004 | Agricultural Soil | MTETWLIVFVVAFVVGLAGLFLYGWRRRNEKPPPGVKPLKDEDDW* |
| Ga0079218_105339204 | 3300007004 | Agricultural Soil | VIETWFLVFIGGALAGLVGLFLYGWSRRKEKPPPGVKPLKDDDDDWR* |
| Ga0079218_109292602 | 3300007004 | Agricultural Soil | VAESWVLVFVVVFVAGLAGLFLYGWRRRKDKPPPGVKPLKDEDDW* |
| Ga0079218_124522291 | 3300007004 | Agricultural Soil | VGVALAGLIGLFLYGWRRRKEEPPPGVKPLKDEDDDWGR* |
| Ga0079218_126391942 | 3300007004 | Agricultural Soil | MGDSLLITFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0079218_127235732 | 3300007004 | Agricultural Soil | MSGNWLIVFVGVFVAGLVGLFLYGWLRRKERPPPGVKPIKDEDW* |
| Ga0075435_1012255202 | 3300007076 | Populus Rhizosphere | MNESNLWLVIFLVLAVGGLVGMFLFGWKRRKEKPPPGVKPLPPDDDD* |
| Ga0075435_1016658901 | 3300007076 | Populus Rhizosphere | AHGPGQVNGGWLIALVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0099794_100030565 | 3300007265 | Vadose Zone Soil | MFLVLAVGGLVGIFLFGWKRRKDKPPPGVKPLPPDDDDWR* |
| Ga0105095_101185572 | 3300009053 | Freshwater Sediment | MDGGWLVVFVVAFVAGLAGLFLFGWRRRKDPPPPGVKPLPDDDDDWSR* |
| Ga0105095_104784551 | 3300009053 | Freshwater Sediment | MDGGWLVVFVIAFVAGLAGLFLFGWRRRKDPPPPGVKP |
| Ga0105106_100275062 | 3300009078 | Freshwater Sediment | MEGGWLIAFVAAFIAGLAGLFLYGWLRRKDKPPPGVKPLPDDDDDWRR* |
| Ga0105106_105058872 | 3300009078 | Freshwater Sediment | MDGGWLIVFVIAFVAGLAGLFLFGWRRRKDPPPPGVKPLPDDDDDWSR* |
| Ga0105106_112153902 | 3300009078 | Freshwater Sediment | MDGGWLVVFVLAFVVGLAGLFLFGWLRRKDPPPPGVKPLPEDDDDWGR* |
| Ga0105106_113294862 | 3300009078 | Freshwater Sediment | MDGGWLVVFVIAFVAGLAGLFLFGLLRRKDPPPPGVKPLPDDDDDWGR* |
| Ga0105107_100878192 | 3300009087 | Freshwater Sediment | MDGGWLVAFVVAFVAGLAGLFLFGWRRRKDPPPPGVKPLPDDDDDWSR* |
| Ga0105107_101831942 | 3300009087 | Freshwater Sediment | MDGGWLIVFVAAFVAGLAGLFVFGWLRRKDPPPPGVKPLPDDDWGR* |
| Ga0099830_104921062 | 3300009088 | Vadose Zone Soil | MNSTTWLAIFLVFAVGGLVGIFLFGWKRRKDKPPPGVKPLPPDDDDWR* |
| Ga0099828_104076402 | 3300009089 | Vadose Zone Soil | MNSTTWLAIFLVLAVGGLVGIFLFGWKRRKDKPPPGVKPLPPDDDDWR* |
| Ga0099828_112751463 | 3300009089 | Vadose Zone Soil | LAIFLVFAVGGLVGIFLFGWKRRKDKPPPGVKPLPPDDDDWR* |
| Ga0111539_100147986 | 3300009094 | Populus Rhizosphere | MDHSTISLIIFLVLAVGGLIGMFFFGWRRRKEKPPPGVKPLPPDDDDWR* |
| Ga0111539_108033593 | 3300009094 | Populus Rhizosphere | MGDNGWLVFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLRDEDDWK* |
| Ga0079224_1000971433 | 3300009095 | Agricultural Soil | MTPGTLYLVLLLALFVAGIASLFYFGWLRRREKPPPGVKPLPRDDDWD* |
| Ga0105245_109633642 | 3300009098 | Miscanthus Rhizosphere | VSGNWLIILVGVFVAVLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0075418_112171162 | 3300009100 | Populus Rhizosphere | MSEGTLWLVIFLVLAVGGLAGMFLFGWRRRKEKPPPGVKPLPPEDDDWK* |
| Ga0075418_122620562 | 3300009100 | Populus Rhizosphere | MGDSGFILFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLRDEDDWK* |
| Ga0066709_1003799353 | 3300009137 | Grasslands Soil | VNGGWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLNNDDDW* |
| Ga0114129_101602032 | 3300009147 | Populus Rhizosphere | MSANWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDWGR* |
| Ga0114129_108732454 | 3300009147 | Populus Rhizosphere | LDSTLYIVFIGVALAGLIGIFLYGWLRRKEKPPPGVKPLTDADDEKWK* |
| Ga0114129_111168163 | 3300009147 | Populus Rhizosphere | MAGNGLLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDDWGKS* |
| Ga0105094_105040261 | 3300009153 | Freshwater Sediment | MDGGWLIVFVAAFVAGLAGLFVFGWLRRKDPPPPGVKPLPDDDW |
| Ga0111538_121277501 | 3300009156 | Populus Rhizosphere | VGGGWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0075423_103237582 | 3300009162 | Populus Rhizosphere | VNGGWLIALVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDDW* |
| Ga0105100_106704972 | 3300009166 | Freshwater Sediment | MSESWLIIFVGAFIAGLAGVFLYGWLRRKEKPPPGVKPLTDEDDEKWK* |
| Ga0105101_100126745 | 3300009171 | Freshwater Sediment | MDGGWLVVFVVAFVAGLAGLFLFGWRRRKDPPPPGVKPLPDDDDDWGR* |
| Ga0105259_10289252 | 3300009597 | Soil | VNGDWLIVFVGAFVAGLIGLFLYGWLRRKEKPPPGVKPLKDEDDW* |
| Ga0105259_11346282 | 3300009597 | Soil | MSESTLWLVIFLVLAVGGLAGMFLFGWRRRKEKPPPGVKPLPPDEDWK* |
| Ga0105347_10238793 | 3300009609 | Soil | LENALIWFVAFLGLAIAGLGGLFLYGWRRRKEKPPPGVKPLRDEDDDWGR* |
| Ga0105347_15393431 | 3300009609 | Soil | VSEIWLAVFLGAFVVGLGGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0105340_100044910 | 3300009610 | Soil | LENALLWFIVFIGAALAGLIGLFLYGWRRRKEEPPPGVKPLRDEDDDWGR* |
| Ga0105252_100248724 | 3300009678 | Soil | VNGDWLIVFVGALVAGLIGLFLYGWLRRKEKPPPGVKPLKDEDDW* |
| Ga0126309_112936332 | 3300010039 | Serpentine Soil | MGERWLIVFVVVFVAGLIGVFLYGWLRRKEKPPPGVKPLKDDDW* |
| Ga0126311_111776053 | 3300010045 | Serpentine Soil | FIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK* |
| Ga0126382_104741982 | 3300010047 | Tropical Forest Soil | VSAIWLAVFVGAFVAGLAGLFLYGWLKRKEKPPPGVKPLKDDDDW* |
| Ga0134080_104369741 | 3300010333 | Grasslands Soil | VFVAGLIGLFLYGWLRRKEKPPPGVKPLKDEDDW* |
| Ga0126377_107465182 | 3300010362 | Tropical Forest Soil | ADAGSAKASAAMSESTLWLIIFLVLAVGGLIGMFLFGWKRRKEKPPPGVKPLPPEDDWK* |
| Ga0126377_110670632 | 3300010362 | Tropical Forest Soil | VSAIWLAVFVGAFVAGLAGLFLYGWLKRKEKPPPGVKPLKDDDDW |
| Ga0134125_111246172 | 3300010371 | Terrestrial Soil | MGDNGWLVFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDRK* |
| Ga0134127_102671613 | 3300010399 | Terrestrial Soil | VRGGWLIVFVVVFVAGMIGLFLYGWLRCKEKPPPGVKPLKDDDDW* |
| Ga0134127_102879632 | 3300010399 | Terrestrial Soil | VNGGWLIVFVGVFVAGLVGLFLYGWLRRKEKPPPGVKPLKNDDDW* |
| Ga0134127_110010452 | 3300010399 | Terrestrial Soil | MSESTLWLVIFLVLAVGGLAGMFLFGWRRRKEKPPPGVKPLPPEDDDWK* |
| Ga0134127_110765313 | 3300010399 | Terrestrial Soil | MSEGTLWLVIFLVLAVGGLAGMFLFGWLRRKEKPPPGVKPLPPEDDWK* |
| Ga0134127_111021702 | 3300010399 | Terrestrial Soil | VVFLALALAGLLGMFLYGWRRRKEAPPPGVKPLRDDDDDWGR* |
| Ga0134127_114620592 | 3300010399 | Terrestrial Soil | MSESTLWLVIFLVLAVGGLLGMFLFGWRRRKEKPPPGVKPLPPEDDWK* |
| Ga0134127_122325963 | 3300010399 | Terrestrial Soil | ALAVGGLIGMFLFGWMRRKEKPPPGVKPLPPDDDDWK* |
| Ga0134122_102534093 | 3300010400 | Terrestrial Soil | MSESNLWLVIFLVLAVGGLIGMFLFGWMRRKEKPPPGVKPLPPDDDDWK* |
| Ga0134121_102222261 | 3300010401 | Terrestrial Soil | MSESNLWLVIFLVLAVGGLAGMFLFGWKRRKEKPPPGVKPLPPDDDWK* |
| Ga0134123_101043781 | 3300010403 | Terrestrial Soil | MGDNGWLVFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDW |
| Ga0134123_117740001 | 3300010403 | Terrestrial Soil | MSESNLWLVIFLALAVGGLAGMFLFGWKRRKEKPPPGVKPLPPDDDDWK* |
| Ga0137392_103705932 | 3300011269 | Vadose Zone Soil | MNSTTWLAIFLVFAVGGLVGIFLFGWKRRKDKPPPGVKPLPPDDDDRR* |
| Ga0127502_102343543 | 3300011333 | Soil | MGDNLFIVFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0137348_10208262 | 3300011398 | Soil | LENILIWFVVFLGTALAGLGGLFLYGWARRKEKPPPGVKPLKDEDDDWGR* |
| Ga0137466_10132872 | 3300011399 | Soil | MSESTLWLIIFLVLAVGGIAGMFLFGWRRRKEKPPPGVKPLPPDDDWK* |
| Ga0137356_10195503 | 3300011402 | Soil | WFVAFLGLAIAGLGGLFLYGWLRREEKPPPGVKPLRDEDDDWGR* |
| Ga0137313_10133122 | 3300011403 | Soil | LENALIWFVAFLGLAIAGLGGLFLYGWRRREEKPPPGVKPLRDEDDDWGR* |
| Ga0137340_10109983 | 3300011405 | Soil | LENALIWFVAFLGLALAGLGGLFLYGWRRRKEKPPPGVKALRDEDDDWGR* |
| Ga0137333_10430854 | 3300011413 | Soil | LFIIFIGSDVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDDWGR* |
| Ga0137325_10023893 | 3300011415 | Soil | LENALIWFVAFLGLAIAGLGGLFLYGWQRRKEKPPPGVKPLRDEDDDWGR* |
| Ga0137326_10068201 | 3300011417 | Soil | LIWFVAFLGLAIAGLGGLFLYGWRRRKEKPPPGVKALRDEDDDWGR* |
| Ga0137423_10052441 | 3300011430 | Soil | ENALIWFVAFLGLAIAGLGGLFLYGWRRRKEKPPPGVKPLRDEDDDWGR* |
| Ga0137428_10185384 | 3300011432 | Soil | GQVNGDWLIVFVGALVAGLIGLFLYGWLRRKEKPPPGVKPLKDEDDW* |
| Ga0137428_10210512 | 3300011432 | Soil | LENILIWFVVFLGTALAGLGGLFLYGWARRKEKPPPGVKPLKDEDDDWR* |
| Ga0137464_10165842 | 3300011434 | Soil | LENALIWFVAFLGLAIAGLGGLLLYGWRRRKEKPPPGVKPLRDEDDDWGR* |
| Ga0137464_10402072 | 3300011434 | Soil | VSVIWLAVFLGAFVVGLGGLFLYGWLRRKEKPPPGVKPLKDDDDDW* |
| Ga0137451_11474722 | 3300011438 | Soil | MSGSTLWLIIFLILAIGGLVGIFLFGWKRRKEKPPPGVKPLPPDDDD* |
| Ga0137451_12815792 | 3300011438 | Soil | LDSTLYIVFIGVALAGLVGMFLYGWLRRKEKPPPGVKPLTDADDERWK* |
| Ga0137432_11009532 | 3300011439 | Soil | VIETWFLVFIGVAIAGLVGLFLYGWGRRKEKPPPGVKPLKDDDDDWR* |
| Ga0137437_10812662 | 3300011442 | Soil | MNESTLWLIIFLVLAIGGLVGIFLFGWKRRKEKPPPGVKPLPPDDD* |
| Ga0137463_10219393 | 3300011444 | Soil | MFLVLAVGGLVGIFLFGWKRRKEKPPPGVKPLPPDDDD* |
| Ga0137427_100481813 | 3300011445 | Soil | LEPTLYIVFIGVAVAGLIGLFLYGWMRRNEKPPPGVKPLKDDDDWDK* |
| Ga0137427_100620123 | 3300011445 | Soil | VNGDWLIVFVGAFVAGLIGLFLYGWLRRKEKPPPGVKPLKDE |
| Ga0120182_10065454 | 3300011993 | Terrestrial | FLGVSLAGLGGMFLYGWMRRKEAPPPGVKPLKDDDDWGR* |
| Ga0137453_10303032 | 3300012034 | Soil | MDDSLFIIFIGGAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0137421_12493712 | 3300012039 | Soil | LENILIWLVVFLGTALAGLGGLFLYGWARRKEKPPPGVKPLKDEDDDWR* |
| Ga0137332_10363251 | 3300012122 | Soil | IAGLGGLFLYGWLRREEKPPPGVKPLRDEDDDWGR* |
| Ga0137344_10093881 | 3300012159 | Soil | LENILIWFVVFLGTALAGLGGLFLYGWSRRKEKPPPGVKPLKDEDDDWGR* |
| Ga0137349_10903232 | 3300012160 | Soil | GALENILIWFVVFLGTALAGLGGLFLYGWARRKEKPPPGVKPLKDEDDDWGR* |
| Ga0137336_10159643 | 3300012161 | Soil | LENALIWFVAFLGLAIAGLGGLFLYGWRRRKEKPPPGGKALRDEDDDWGR* |
| Ga0137355_10333683 | 3300012163 | Soil | MDGSLFIIFIGSAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDDWGR* |
| Ga0137319_10403573 | 3300012167 | Soil | GDWLIVFVGALVAGLVGLFLYGWLRRKEKPPPGVKPLKDEDDW* |
| Ga0137388_109254622 | 3300012189 | Vadose Zone Soil | MSESTLWLAVFLVLAVGGLVGIFLFGWKRRKDKPPPGVKPLPPDDDDWR* |
| Ga0137388_112553412 | 3300012189 | Vadose Zone Soil | MNSTTWLAIFLVFAVGGLVGIFLFGWRRRKDKPPPGLKPLPPDDDDWR* |
| Ga0137374_100311202 | 3300012204 | Vadose Zone Soil | MNSTTWLAIFLVFAVGGLVGIFLFGWKRRKDKPPPGVKPLPPDDDW* |
| Ga0137380_104277002 | 3300012206 | Vadose Zone Soil | MNSTTWLVIFLVLAVGGLVGIFLFGWKRRKDKPPPGVKPLPPDDDDWR* |
| Ga0150985_1060130232 | 3300012212 | Avena Fatua Rhizosphere | MNGNWLIILVCALVAGLIGLFLYGWLRRGDKPPTGVKPLKDDDDW* |
| Ga0137435_10407542 | 3300012232 | Soil | LDSTLYIVFIGVALAGLVGIFLYGWLRRKEKPPPGVKPLTDADDERWK* |
| Ga0150984_1030026902 | 3300012469 | Avena Fatua Rhizosphere | MSESVLWLVMFLVLAVGGLFCMFLFGWKRRGEKPPPGVKPLPPDDDDWRK* |
| Ga0150984_1120576252 | 3300012469 | Avena Fatua Rhizosphere | MSGSWLIILVGAFVAGLIGLFFYGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0150984_1162189162 | 3300012469 | Avena Fatua Rhizosphere | VSGGWLIVFVGVFVAGLIGLFLFGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0137397_100847163 | 3300012685 | Vadose Zone Soil | VSGNWLLVLVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDW* |
| Ga0157285_100545164 | 3300012897 | Soil | DNGWLVFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK* |
| Ga0157296_100556803 | 3300012905 | Soil | MGDNGFLIFIGLAIAGLVGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0157283_100728582 | 3300012907 | Soil | MSGGWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0157286_101764652 | 3300012908 | Soil | MGDNGFLIFIGLAIAGLVGLFLYGWMRRKEKPPPGVKPLKDDEDDWK* |
| Ga0157308_100211851 | 3300012910 | Soil | VSSNWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0137394_102343412 | 3300012922 | Vadose Zone Soil | MSGNWLLVLVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDW* |
| Ga0137410_100003605 | 3300012944 | Vadose Zone Soil | VLAIGGLIGLFLFGWKRRKEKPPPGVKPLPPDDDR* |
| Ga0164299_108444522 | 3300012958 | Soil | VSSTWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0164301_105885942 | 3300012960 | Soil | VSSTWLIVFVGVFVAGLLGLFLYGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0126369_124377862 | 3300012971 | Tropical Forest Soil | MDHSTISLIIFLVLAIGGLIGMFLFGWKRRKEKPPPGVKPLPPDDDW* |
| Ga0157373_107384742 | 3300013100 | Corn Rhizosphere | VSGNWLIILVGVFVAGLIGLFLYGWLRRKEKPPPGGKPLKDDDDW* |
| Ga0157378_125572652 | 3300013297 | Miscanthus Rhizosphere | VLTVGGLAGMFLFGSRRRKEKPPPGVKPLPPDDDWK* |
| Ga0157372_113806402 | 3300013307 | Corn Rhizosphere | VSGNWLIILVGVCVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW* |
| Ga0075354_10039122 | 3300014308 | Natural And Restored Wetlands | MSESTLWLIIFLVLAVGGLVGMFLFGWWRRKEKPPPGVKPLPPDDDWK* |
| Ga0180068_10702813 | 3300014864 | Soil | LENALIWFVAFLGLALAGLGGLFLYGWRRRKEKPPPGVKPLRDEDDDWGR* |
| Ga0180088_10782833 | 3300014868 | Soil | AGLGGLFLYGWRRRKEKPPPGVKALRDEDDDWGR* |
| Ga0180095_10841562 | 3300014871 | Soil | MDGSLFIIFIGSAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK* |
| Ga0180087_11013851 | 3300014872 | Soil | WLIVFVGALVAGLIGLFLYGWLRRKEKPPPGVKPLKDEDDW* |
| Ga0180062_11143512 | 3300014879 | Soil | LENALIWFVAFLGLALAGLGGLFLYGWRRRKEKPPPGVKALRDEDDEWGR* |
| Ga0157379_121518333 | 3300014968 | Switchgrass Rhizosphere | HRHSPMGDNGWLVFIGLAVAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK* |
| Ga0167654_10472812 | 3300015084 | Glacier Forefield Soil | MNESNLWLVIFLVLAVGGLVGLFFFGWRRRKEKPPPGVKPLPPDDD* |
| Ga0120098_10582083 | 3300015170 | Fossill | LNETWFILFIGVAIAGLIGLFLYGWLRRKEKPPPGVKPLKDDEDDWK* |
| Ga0173480_109117102 | 3300015200 | Soil | MGDNGFLIFIGLAIAGLVGLFLYGWMRRKEKPPPGVKPLKDDE |
| Ga0137409_104524673 | 3300015245 | Vadose Zone Soil | VIFLVLAVGGLVGMFLFGWKRRKEKPPPGVKPLPPDDDDWR* |
| Ga0132258_103887995 | 3300015371 | Arabidopsis Rhizosphere | MDHSTISLIIFLVLAVGGLIGMFFFGWRRRKEKPPPGVKPLPPDDDDWK* |
| Ga0132258_110466303 | 3300015371 | Arabidopsis Rhizosphere | MADSGWIILIGGLIAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDDWGR* |
| Ga0132256_1000782324 | 3300015372 | Arabidopsis Rhizosphere | VSGGWLIVFVGVFVAGLIGLFLSGWLRRKDKPPPGVKPLKDDDDW* |
| Ga0184605_100648142 | 3300018027 | Groundwater Sediment | MGEHWLIVFVVVFVAGLIGVFLYGWLRRKEKPPPGVKPIKDDDW |
| Ga0184605_101281322 | 3300018027 | Groundwater Sediment | MSGNWLIVFVGVFVAGLVGLFLYGWLRRKEKPPPGVKPLKDDDW |
| Ga0184608_104759482 | 3300018028 | Groundwater Sediment | VSGNWLIIFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDEDDW |
| Ga0184623_101950642 | 3300018056 | Groundwater Sediment | LENILIWFVVFLGTALAGLGGLFLYGWARRKEKPPPGVKPLEDEDDDWGR |
| Ga0190265_1001400910 | 3300018422 | Soil | VIEDWFIVFTGFALAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDDWGR |
| Ga0190265_100234482 | 3300018422 | Soil | VTADWLIIFVGVFVAGLVGLFLYGWLRRKEKPPPGVRPLTQEDDEKWK |
| Ga0190265_100236099 | 3300018422 | Soil | MGDSLFTVFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190265_100373544 | 3300018422 | Soil | MDGSWLIVFVALFIAGLAGLFLYGWLRRKEKPPPGVKPLPDNDDWDR |
| Ga0190265_101630893 | 3300018422 | Soil | LENALLSFIVFIGVALAGLIGLFLYGWSRRKEKPPPGVKPLKDEEDW |
| Ga0190265_103377652 | 3300018422 | Soil | MAGTWLIVFVGLFVAGLAGLFAYGWLRRKQKPPPGVKPLPDNDDWDR |
| Ga0190265_104697322 | 3300018422 | Soil | LENALLSFIVFIGVALAGLIGLFLYGWRRRNEKPPPGVKPLKDEEDW |
| Ga0190265_108638463 | 3300018422 | Soil | MDDSLFIVFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190265_137731851 | 3300018422 | Soil | MSETWLIVFVVAFVVGLAGLFLYGWRRRNENPPPGVKPLKDEDDW |
| Ga0190272_100043194 | 3300018429 | Soil | VTPNWLIIFVGIFVAGLVGLFLYGWLRRKERPPPGVKPLTEEDDEKWK |
| Ga0190272_100163942 | 3300018429 | Soil | LENALLPFIVFIGVALAGLIGLFLYGWRRRNEKPPPGVKPLKDDDDDWGK |
| Ga0190272_105965182 | 3300018429 | Soil | MDDSFFIVFIGAAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190272_114806552 | 3300018429 | Soil | MGDSLFIIFIGAAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190272_117255801 | 3300018429 | Soil | YHCRVIEGWFVVFTGVALAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDDWGR |
| Ga0190272_118368351 | 3300018429 | Soil | VGLFVAGLAGLFVYGWLRRKEKPPPGVKPLPDNDDWDR |
| Ga0190272_125397691 | 3300018429 | Soil | VTPNWLIIFVGVFVAGLVGLFLYGWLRRRERPPPGVKPLTEEDDEKWK |
| Ga0190275_103592333 | 3300018432 | Soil | MDDSLFIVFIGAAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190275_105333011 | 3300018432 | Soil | RCMVRARPGSMDDNLFIVFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190269_110284073 | 3300018465 | Soil | MDDSLFMIFIGAAVAGLIGLFLYGWTRRKEKPPPGVKPLKDEDDWK |
| Ga0190268_114066362 | 3300018466 | Soil | MGESGFIIFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190268_118731401 | 3300018466 | Soil | VIETWFLVFIGVAIAGLVGLFLYGWGRRKEKPPPGVKPLKDDDDDWR |
| Ga0066662_126731131 | 3300018468 | Grasslands Soil | MGGRWLIVFVVVFVAGLIGVFLYGWLRRKDKPPPGVKPLKDDDW |
| Ga0190270_104021874 | 3300018469 | Soil | MGESGFILFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190270_115143092 | 3300018469 | Soil | MGESGFIIFIGVAVAGLIGVFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190274_104069865 | 3300018476 | Soil | MGDSGFIIFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0180110_10367623 | 3300019208 | Groundwater Sediment | MDGSLFIIFIGSAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDDWGR |
| Ga0180115_13442832 | 3300019257 | Groundwater Sediment | LENALIWFVAFLGLALAGLGGLFLYGWRRRKEKPPPGVKALRDEDDDWGR |
| Ga0173482_107383472 | 3300019361 | Soil | MGDNGWLVFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190264_100282474 | 3300019377 | Soil | MDDSLFIIFIGAAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190264_102542542 | 3300019377 | Soil | MDDSLFLVFIGAAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190264_105569033 | 3300019377 | Soil | MGDSAFIVFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0190264_112193032 | 3300019377 | Soil | VNGGWLIVFVAAFVTGLIGLFLFGWLRRKEKPPPGVKPLPPDDDD |
| Ga0187892_100064959 | 3300019458 | Bio-Ooze | VAIAGLIGLFLYGWSRRKEKPPPGVKPLKDEEDDWGR |
| Ga0193741_10172964 | 3300019884 | Soil | MEDSLFIVFIGAAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0180108_12291252 | 3300020066 | Groundwater Sediment | VSEIWLAVFLGAFVVGLGGLFLYGWLRRKEKPPPGVKPLKDEDDW |
| Ga0196977_11136281 | 3300020146 | Soil | MSEGTFWLVVFLGGAAAALGGLFLFGWFRRKDKPPPGVKPLPKDDDWD |
| Ga0196976_10249543 | 3300020147 | Soil | FWLVVFLGGAAAALGGLFLFGWFRRKDKPPPGVKPLPKDDDWD |
| Ga0196964_100137272 | 3300020202 | Soil | VLWFTVFLGIAIAGLIGLFLYGWHRRKEKPPPGVKPLPDEDDWGR |
| Ga0196964_100345184 | 3300020202 | Soil | VVFLGVALAGLGGMFLYGWLRRKEAPPPGVKPLKDDDDDWGR |
| Ga0196964_102354852 | 3300020202 | Soil | VSQTWLVVFVVAFVVGLAGLFFYGWRRRNEKPPPGIKPLKDEDDW |
| Ga0196964_102812572 | 3300020202 | Soil | VNGGWLIVFVAAFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW |
| Ga0196964_103389342 | 3300020202 | Soil | VNENWFIIFIGVAVAGLIGLFLYGWSRRKEKPPPGVKPLKDEDDWR |
| Ga0196964_104735612 | 3300020202 | Soil | VNGGWLIVFVAAFVVGLIGLFLYGWLRRKEKPPPGVKPLKDEDDW |
| Ga0196963_100234942 | 3300020215 | Soil | MGEIGWIVFIGVAIAGMVGLFLYGWMRRKEKPPPGIKPLKDEDWD |
| Ga0196963_101505094 | 3300020215 | Soil | SQNGRFGLENPLIWLVIFLGAAIAALGGMFLYGWLRRKEAPPPGVKPLKDEDDWE |
| Ga0196963_102173612 | 3300020215 | Soil | MDGTSWLVLFLGLALAGLAGLFLFGWIRRKDKPPPGVKPLPPDDDDWK |
| Ga0196981_10458973 | 3300021057 | Soil | MDERIFIVFIGAAIAGLAGLFLYGWMRRKEKPPPGVKPLKDEDWD |
| Ga0196980_10122092 | 3300021066 | Soil | MDGTAWLILFLGLALAGLAGLFLFGWIRRKDKPPPGVKPLPPDDDWK |
| Ga0196980_10525142 | 3300021066 | Soil | LENAATWLVVFLGLALAGLGGLFLYGWMRRKDRPPPGVKPLPPEDDWK |
| Ga0210380_102667892 | 3300021082 | Groundwater Sediment | MSGNWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW |
| Ga0222622_113351332 | 3300022756 | Groundwater Sediment | MGEHWLIVFVVVFVAGLIGVFLYGWLRRKEKPPPGVKPLKDDDW |
| Ga0247754_11339862 | 3300023102 | Soil | MGDNGFLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK |
| Ga0247686_10006443 | 3300024177 | Soil | VSGNWLIILVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW |
| Ga0247686_10526152 | 3300024177 | Soil | PAMNESTLWLIIFLVLAVGGLAGMFLFGWRRRKEKPPPGVKPLPPEEDWK |
| Ga0247660_10125413 | 3300024317 | Soil | ATARPAMNESTLWLIIFLVLAVGGLAGMFLFGWRRRKEKPPPGVKPLPPEEDWK |
| Ga0196962_102620732 | 3300024430 | Soil | MDDSLFIIFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0209320_100305282 | 3300025155 | Soil | VAESWLIVFVGVFVAGLAGLFLYGWLRRKEKPPPGVKPLKDDDDDWDR |
| Ga0209642_101731212 | 3300025167 | Soil | MDDSLFIIFIGVAVAGLIGLFLYGWRRRKEKPPPGVKPLKDEDDWK |
| Ga0207682_103026322 | 3300025893 | Miscanthus Rhizosphere | MGDSGFLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK |
| Ga0207688_101053971 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | PHSPMGDSGFLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK |
| Ga0207660_100948935 | 3300025917 | Corn Rhizosphere | VAIAGLVGLFLYGWGRRKEKPPPGVKPLKDDDDDWR |
| Ga0207660_103336642 | 3300025917 | Corn Rhizosphere | LESTLLWFIVFVGVALAGLIGLFLYGWRRRQEPPPPGVKPLKDDEDDWGR |
| Ga0207662_100397692 | 3300025918 | Switchgrass Rhizosphere | MGDNGWLVFIGLAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0207681_103624522 | 3300025923 | Switchgrass Rhizosphere | VSGNWLIILVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDD |
| Ga0207701_110003991 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDSGFLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDD |
| Ga0207667_107255811 | 3300025949 | Corn Rhizosphere | VSGGWLIVFVGVFVAGLIGVFLYGWLRRKEKPPPGVKPLKDDDDW |
| Ga0207651_115927722 | 3300025960 | Switchgrass Rhizosphere | TISLIIFLVLAVGGLIGMFFFGWRRRKEKPPPGVKPLPPDDDDWK |
| Ga0207708_102344062 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEDWFIVFTGFAVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDDWGR |
| Ga0207641_104487722 | 3300026088 | Switchgrass Rhizosphere | VGGGWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW |
| Ga0207641_111648441 | 3300026088 | Switchgrass Rhizosphere | FIGIAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0207675_1007161473 | 3300026118 | Switchgrass Rhizosphere | VTEDWFIVFTGFAVAGLIGLFLYGWLRRKEKPPPGVKPL |
| Ga0209027_12551981 | 3300026300 | Grasslands Soil | MSASYWLIIFLVLAIGGLVGIFLFGWKRRREKPPPGVKPLPP |
| Ga0209057_12122722 | 3300026342 | Soil | LALGGLVGIFLYGWKRRKEKPPRVAPLPKDDDWDR |
| Ga0208185_10012975 | 3300027533 | Soil | LENALLWFIVFIGAALAGLIGLFLYGWRRRKEEPPPGVKPLRDEDDDWGR |
| Ga0209999_10604543 | 3300027543 | Arabidopsis Thaliana Rhizosphere | FLGAALAGLGGMFLYGWMRRKEAPPPGVKPLKDDDDWGR |
| Ga0208454_10069102 | 3300027573 | Soil | LENALIWFVAFLGLAIAGLGGLFLYGWQRRKEKPPPGVKPLRDEDDDWGR |
| Ga0209818_10047972 | 3300027637 | Agricultural Soil | MDAAWLIVFVGAFIAGLAGLFLYGWLRRKEKPPPGVKPLPDNDDWDR |
| Ga0209818_10340674 | 3300027637 | Agricultural Soil | MGDNLFIVFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0209818_11281652 | 3300027637 | Agricultural Soil | MSGGGWLIVFLGLAIAGLAGLFLYGWLRRKEKPPPGVKPLPPDDDDWRR |
| Ga0209387_11010292 | 3300027639 | Agricultural Soil | LEPTLYIVFIGVALAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDWDR |
| Ga0209387_11665451 | 3300027639 | Agricultural Soil | VTDDWFIVFTGVAVAGLIGLFLYGWLRRKEKPPPGVKPLKDDD |
| Ga0209387_12180681 | 3300027639 | Agricultural Soil | VTDDWFIVFTGVAVAGLIGLFLYGWLRRKEKPPPGVKLKDDDDDWGR |
| Ga0207873_11291842 | 3300027664 | Feedstock Adapted Compost | MTPGTLYLVLLLALFVAGIASLFYFGWLRRREKPPPGVKPLPRDDDWD |
| Ga0209966_10019411 | 3300027695 | Arabidopsis Thaliana Rhizosphere | LQDRAPGLEDSLIWLVLFLGAALAGLGGMFLYGWMRRKEAPPPGVKPLKDDDDWGR |
| Ga0209966_10080122 | 3300027695 | Arabidopsis Thaliana Rhizosphere | VVFLALALAGLLGMFLYGWRRRKEAPPPGVKPLRDDDDDWGR |
| Ga0209286_10732142 | 3300027713 | Freshwater Sediment | MDGGWLIVFVIAFVAGLAGLFLFGWRRRKDPPPPGVKPLPDDDDDWSR |
| Ga0209703_10261584 | 3300027723 | Freshwater Sediment | MDGGWLVVFVVAFVAGLAGLFLFGWRRRKDPPPPGVKPLPDDDDDWSR |
| Ga0209464_100692332 | 3300027778 | Wetland Sediment | MGDNGFIVFVGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0209706_101089943 | 3300027818 | Freshwater Sediment | MDGGWLIVFVAAFVAGLAGLFVFGWLRRKDPPPPGVKPLPDDDWGR |
| Ga0209811_100088452 | 3300027821 | Surface Soil | VSSTWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW |
| Ga0209811_102239311 | 3300027821 | Surface Soil | WLVIFLVLAVGGLAGMFLFGWKRRKEKPPPGVKPLPPDDDWK |
| Ga0209814_102286012 | 3300027873 | Populus Rhizosphere | VSGGWLIALVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW |
| Ga0209814_103225863 | 3300027873 | Populus Rhizosphere | MSATWLAIFVGAFVAGLFGLFLYGWLRRKEKPPPGVKPLKDDEDDW |
| Ga0209481_100015514 | 3300027880 | Populus Rhizosphere | VSGGWLIALVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDDW |
| Ga0209481_102840154 | 3300027880 | Populus Rhizosphere | IAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDWGKS |
| Ga0209481_107700442 | 3300027880 | Populus Rhizosphere | MGDNGWLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDDWG |
| Ga0209486_100400164 | 3300027886 | Agricultural Soil | VIETWFLVFIGGALAGLVGLFLYGWSRRKEKPPPGVKPLKDDDDDWR |
| Ga0209486_102529352 | 3300027886 | Agricultural Soil | MTETWLIVFVVAFVVGLAGLFLYGWRRRNEKPPPGVKPLKDEDDW |
| Ga0209486_105108411 | 3300027886 | Agricultural Soil | SWVLVFVVVFVAGLAGLFLYGWRRRKDKPPPGVKPLKDEDDW |
| Ga0209486_105170063 | 3300027886 | Agricultural Soil | VTDDWFIVFTGVAVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDDWGR |
| Ga0207428_100384973 | 3300027907 | Populus Rhizosphere | MGDNGWLVFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLRDEDDWK |
| Ga0209382_119364361 | 3300027909 | Populus Rhizosphere | RMSATWLAIFVGAFVAGLVGLFLYGWLRRKEKPPPGVKPLKDDEDDW |
| Ga0209382_120537932 | 3300027909 | Populus Rhizosphere | MAGNGLLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDDWGKS |
| Ga0209705_102416672 | 3300027979 | Freshwater Sediment | MEGGWLIAFVAAFIAGLAGLFLYGWLRRKDKPPPGVKPLPDDDDDWRR |
| Ga0209705_105658082 | 3300027979 | Freshwater Sediment | MDGGWLVVFVLAFVVGLAGLFLFGWLRRKDPPPPGVKPLPEDDDDWGR |
| Ga0268265_101515263 | 3300028380 | Switchgrass Rhizosphere | MGDSGFILFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0268264_100664704 | 3300028381 | Switchgrass Rhizosphere | LIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW |
| Ga0268264_116920472 | 3300028381 | Switchgrass Rhizosphere | MGDNGFLIFIGIAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0247822_101661861 | 3300028592 | Soil | MDDSLFIVFIGAAVAGLIGLFLYGWMRRKEKPPPGVK |
| Ga0247822_102886774 | 3300028592 | Soil | IGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK |
| Ga0247824_100172294 | 3300028809 | Soil | MGDSGWLIFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDDDDWGKS |
| Ga0247824_100739633 | 3300028809 | Soil | VSEIWLAVFLGAFVVGLGGLFLYGWLRRKEKPPPGVKPLKDDDDDW |
| Ga0247825_100183765 | 3300028812 | Soil | VFLALALAGLLGMFLYGWRRRKEAPPPGVKPLRDDDDDWGR |
| Ga0247825_100813632 | 3300028812 | Soil | MGDNGWLVFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK |
| Ga0247825_103319462 | 3300028812 | Soil | VNGGWLIVFVAAFVAGLIGLFLYGWLRRREKPPPGVKPLPPDDD |
| Ga0247825_104908603 | 3300028812 | Soil | MEGGWLIAFVAAFIAGLAGLFLYGWLRRKETPPPGVKPLPDDDDDWGR |
| Ga0247825_113909441 | 3300028812 | Soil | SLIWLVLFLGVALAGLGGMFLYGWMRRKEAPPPGVKPLKDDDDWGR |
| Ga0299907_100061473 | 3300030006 | Soil | MDGGWLIVFVALFIASLAGLFLYGWRRRQEKPPPGVKPLPDDDDDWDR |
| Ga0299907_111052702 | 3300030006 | Soil | MEGYGLILFVGLFIVGLAGLFLFGWLRRKENPPPGVKPLPDDDDDWRH |
| Ga0268386_109566622 | 3300030619 | Soil | MDGGWLIVFVALFIASLAGLFLYGWRRRKEKPPPGVKPLPDDDDWDR |
| Ga0299913_100594054 | 3300031229 | Soil | MDGGWLIVFVALFIASLAGLFLYGWRRRKEKPPPGVKPLPDDDDDWDR |
| Ga0310887_101067701 | 3300031547 | Soil | LAIAGLIGLFLYGWMRRKEKPPPGVKPLKDDEDDWK |
| Ga0310887_109446311 | 3300031547 | Soil | VNGGWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW |
| Ga0307408_1002291332 | 3300031548 | Rhizosphere | VTEDWFIVFTGVALAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDDWGR |
| Ga0307408_1006259354 | 3300031548 | Rhizosphere | MGDSLFIVFIGAAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0307408_1015819791 | 3300031548 | Rhizosphere | MGDSGFIIFIGVAVAGLIGLFLYGWMRRKEKPPPGVK |
| Ga0310886_102642831 | 3300031562 | Soil | VSGGWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKP |
| Ga0307469_122919952 | 3300031720 | Hardwood Forest Soil | VNGNWLIVLVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW |
| Ga0307405_108973271 | 3300031731 | Rhizosphere | LWLVIFLVLAVGGLVGMFLFGWRRRKEKPPPGVKPLPPEDDDWK |
| Ga0307405_115028762 | 3300031731 | Rhizosphere | VNETWLIVFVGLFVAGLAGLFLYGWLRRKEKPPPGVKPLKD |
| Ga0307405_116504642 | 3300031731 | Rhizosphere | VDWLLALIGLAIAGLVGLFLYGWMRRKEKPPPGVKPLKDEDWD |
| Ga0307468_1001792033 | 3300031740 | Hardwood Forest Soil | MNESTLWLVLFLALAVGGLVGMFLFGWKRRKEKPPPGVKPLPPDDDD |
| Ga0307468_1002062194 | 3300031740 | Hardwood Forest Soil | NWLIVFVGAFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDDWRK |
| Ga0307468_1006576382 | 3300031740 | Hardwood Forest Soil | MSGGWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDD |
| Ga0307468_1012990012 | 3300031740 | Hardwood Forest Soil | VSGGWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW |
| Ga0307468_1018386562 | 3300031740 | Hardwood Forest Soil | VNGGWLIVFVGLFVAGLIGLFLYGWLRRKEKPPPGVKPLPPDDDD |
| Ga0307468_1021590012 | 3300031740 | Hardwood Forest Soil | MGDSGFLLFIGLAIAGLVGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0307473_104810182 | 3300031820 | Hardwood Forest Soil | VSGYWLIVFVGAFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW |
| Ga0307413_112656562 | 3300031824 | Rhizosphere | VLFLGLALAGLGGMFLYGWRRRKEKPPPGVKPLRDEDDWK |
| Ga0307410_104475491 | 3300031852 | Rhizosphere | FLGLALAGLGGMFLYGWRRRKEKPPPGVKPLRDEDDWK |
| Ga0310904_105739512 | 3300031854 | Soil | VSEIWLAVFLGAFVVGLGGLFLYGWLRRKEKPPPGVKPLKDDDDD |
| Ga0307406_106863453 | 3300031901 | Rhizosphere | MDDSLFIIFIGIAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0307412_117445722 | 3300031911 | Rhizosphere | VNETWLIVFVGLFVAGLAGLFLYGWLRRKEKPPPGVKPLKDEDDWK |
| Ga0310885_106434502 | 3300031943 | Soil | QDLHRRRPAHGPGQVNGGWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW |
| Ga0310884_109051561 | 3300031944 | Soil | STWLIVFVGVFVAGLLGLFLYGWLRRKDKPPPGVKPLKDDDDW |
| Ga0310903_108470532 | 3300032000 | Soil | VSGNWLIIFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW |
| Ga0307416_1002599652 | 3300032002 | Rhizosphere | MGDSLFIAFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0307416_1029904832 | 3300032002 | Rhizosphere | MGDSLFIIFIGAAVAGLIGLFLYGWLRRKEKPPPGVKPLKD |
| Ga0307411_101873993 | 3300032005 | Rhizosphere | MGDSLLIVFIGVAVAGLIGLFLDGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0307411_102425171 | 3300032005 | Rhizosphere | GVALAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDDWGR |
| Ga0307411_108220132 | 3300032005 | Rhizosphere | VSESWLIVFVGLFVAGLAGLFLYGWLRRKEKPPPGVKPLKDEDDWK |
| Ga0307411_116813262 | 3300032005 | Rhizosphere | VADNLWIILIGAALAGLVGLFLYGWMRRKEKPPPGVKPLKDDDDDWGR |
| Ga0310906_100184231 | 3300032013 | Soil | MGDSGFILFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDED |
| Ga0310906_110221002 | 3300032013 | Soil | FVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW |
| Ga0310899_100824824 | 3300032017 | Soil | GFILFIGLAIAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0310899_106860522 | 3300032017 | Soil | VSSTWLIVFVGVFVAGLLGLFLYGWLRRKDKPPPGVKPLKDDDDW |
| Ga0307415_1015628932 | 3300032126 | Rhizosphere | VSETWLIVFVGLFVAGLAGLFLYGWLRRKEKPPPGVKPLKDEDDWK |
| Ga0315910_1001737010 | 3300032144 | Soil | MDDSLFIVFIGAAVAGLIGLFLYGWMRRNEKPPPGVKPLKDEDDWK |
| Ga0315910_100308029 | 3300032144 | Soil | VTEDWFIVFTGVALAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDDWGK |
| Ga0315910_100959064 | 3300032144 | Soil | MEGGWLIAFVAAFIAGLAGLFLYGWLRRKERPPPGVKPLPDDDDDWGR |
| Ga0315912_110689781 | 3300032157 | Soil | WLVLFLGLALAGLGGMFLYGWRRRKEKPPPGVKPLRDEDDWK |
| Ga0307470_106713572 | 3300032174 | Hardwood Forest Soil | VSGNWLIVFVGAFVAGLIGLFLYGWLRRKDKPPPGVKPLKDDDDW |
| Ga0307470_113148901 | 3300032174 | Hardwood Forest Soil | TLWLTIFLVLAIGGLVGMFLFGWKRRKEKPPPGVKPLPPDDDD |
| Ga0307471_1015024882 | 3300032180 | Hardwood Forest Soil | LDPTLYIVFIGVALAGLVGVFLYGWLRRKEKPPPGVKPLTDADDEKWK |
| Ga0307471_1028351271 | 3300032180 | Hardwood Forest Soil | LFLVLAVGGLVGMFLFGWKRRKEKPPPGVKPLPPDDDD |
| Ga0307471_1029465472 | 3300032180 | Hardwood Forest Soil | VNGGWLIAFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW |
| Ga0307472_1002396321 | 3300032205 | Hardwood Forest Soil | MNESTLWLVLFLALAVGGLVGMFLFGWKRRKEKPPPGVKPLPPDDD |
| Ga0307472_1006146872 | 3300032205 | Hardwood Forest Soil | MSESTLWLTIFLVLAIGGLVGMFLFGWKHRKEKPPPGVKPLPPDDD |
| Ga0335085_1002029610 | 3300032770 | Soil | MSESVLWLVIFLVLAVGGLAGLFLFGWRRRKEKPPPGVKPLPPDDDW |
| Ga0214472_107672551 | 3300033407 | Soil | LENTLLGFIVFIGVALAGLIGLFLYGWRRRKEKPPPGVKPLKDDDDDWGR |
| Ga0310810_105743803 | 3300033412 | Soil | MGDNGWLVFIGVAVAGLIGLFLYGWMRRKEKPPPGVKPLKDEDDWK |
| Ga0247829_111685273 | 3300033550 | Soil | SAPGLEDSLIWLVLFLGVALAGLGGMFLYGWMRRKEAPPPGVKPLKDDDDWGR |
| Ga0247830_109860441 | 3300033551 | Soil | DWFIVFTGVAVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDDWGR |
| Ga0364929_0110800_476_622 | 3300034149 | Sediment | LDSTLYIVFIGVALAGLVGIFLYGWLRRKEKPPPGVKPLTDADDEKWK |
| Ga0364933_037843_812_928 | 3300034150 | Sediment | MFLVLAVGGLVGIFLFGWKRRKEKPPPGVKPLPPDDDD |
| Ga0364935_0168533_580_696 | 3300034151 | Sediment | GLAIAGLGGLFLYGWRRRKEKPPPGVKPLRDEDDDWGR |
| Ga0364940_0267976_8_118 | 3300034164 | Sediment | VGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDEDW |
| Ga0364943_0008951_495_638 | 3300034354 | Sediment | MNESTLWLIIFLVLAIGGLVGIFLFGWKRRKEKPPPGVKPLPPDDDD |
| Ga0373958_0042189_814_936 | 3300034819 | Rhizosphere Soil | VNGGWLIVFVGVFVAGLIGLFLYGWLRRKDKPPPGVKPLKD |
| ⦗Top⦘ |