Metagenome / Metatranscriptome Family F004795

Overview

Basic Information

• Family ID: F004795
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 423
• Average Sequence Length: 39 residues
• Representative Sequence: MAKPDETNELSWPWWAPWALLAVAATSLLTIGATLYDIL
• Number of Associated Samples: 194
• Number of Associated Scaffolds: 423

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 58.37 %
• % of genes near scaffold ends (potentially truncated): 16.78 %
• % of genes from short scaffolds (< 2000 bps): 73.05 %
• Associated GOLD sequencing projects: 155
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (91.726 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (17.021 % of family members)
• Environment Ontology (ENVO): Unclassified (50.591 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (64.775 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 34.33%
  β-sheet: 0.00%
  Coil/Unstructured: 65.67%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 423 Family Scaffolds
PF07715	Plug	49.17
PF08479	POTRA_2	20.09
PF03988	DUF347	1.18
PF07238	PilZ	0.95
PF05860	TPS	0.95
PF09678	Caa3_CtaG	0.71
PF13474	SnoaL_3	0.71
PF00034	Cytochrom_C	0.71
PF13485	Peptidase_MA_2	0.71
PF06035	Peptidase_C93	0.71
PF13367	PrsW-protease	0.47
PF14026	DUF4242	0.47
PF00593	TonB_dep_Rec	0.47
PF00115	COX1	0.47
PF12770	CHAT	0.47
PF00497	SBP_bac_3	0.24
PF05239	PRC	0.24
PF00534	Glycos_transf_1	0.24
PF13412	HTH_24	0.24
PF04542	Sigma70_r2	0.24
PF13570	PQQ_3	0.24
PF05940	NnrS	0.24
PF00664	ABC_membrane	0.24
PF01202	SKI	0.24
PF14905	OMP_b-brl_3	0.24
PF10282	Lactonase	0.24
PF08447	PAS_3	0.24

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 423 Family Scaffolds
COG4705	Uncharacterized membrane-anchored protein	Function unknown [S]	1.18
COG3210	Large exoprotein involved in heme utilization or adhesion	Intracellular trafficking, secretion, and vesicular transport [U]	0.95
COG3672	Predicted transglutaminase-like protein	Posttranslational modification, protein turnover, chaperones [O]	0.71
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.24
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.24
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.24
COG3213	Nitric oxide response protein NnrS	Signal transduction mechanisms [T]	0.24
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.24

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	91.73 %
Unclassified	root	N/A	8.27 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	91.73 %
Unclassified	root	N/A	8.27 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	91.73 %
Unclassified	root	N/A	8.27 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	90.07 %
Unclassified	root	N/A	8.27 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	88.89 %
Unclassified	root	N/A	8.27 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %

Level 6

Name	Rank	Taxonomy	Distribution
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	88.18 %
Unclassified	root	N/A	8.27 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.24 %

Level 7

Name	Rank	Taxonomy	Distribution
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	86.05 %
Unclassified	root	N/A	8.27 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.24 %

Level 8

Name	Rank	Taxonomy	Distribution
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	83.45 %
Unclassified	root	N/A	8.27 %
Allosphingosinicella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Allosphingosinicella	0.47 %
unclassified Xanthomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae	0.24 %

Level 9

Name	Rank	Taxonomy	Distribution
Sphingomonas segetis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	19.86 %
unclassified Sphingomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas	16.31 %
Unclassified	root	N/A	8.27 %
Sphingomonas sabuli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	5.91 %
Allosphingosinicella indica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Allosphingosinicella → Allosphingosinicella indica	0.47 %
Xanthomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium	0.24 %

Level 10

Name	Rank	Taxonomy	Distribution
Sphingomonas segetis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	19.86 %
Sphingomonas sp. URHD0057	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	12.06 %
Unclassified	root	N/A	8.27 %
Sphingomonas sabuli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	5.91 %
Sphingomonas sp. URHD0007	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	2.36 %
Sphingomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	1.65 %
Allosphingosinicella indica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Allosphingosinicella → Allosphingosinicella indica	0.47 %
Sphingomonas sp. SE220	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220	0.24 %
Xanthomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium	0.24 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2199352024|deeps__Contig_188124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	2180
2199352024|deeps__Contig_71479	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	1700
3300001979|JGI24740J21852_10048144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	1240
3300001979|JGI24740J21852_10182538	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	520
3300001989|JGI24739J22299_10188801	Not Available	606
3300001991|JGI24743J22301_10050130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	849
3300002067|JGI24735J21928_10191688	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	592
3300002568|C688J35102_118460431	Not Available	562
3300002568|C688J35102_119443938	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	696
3300002568|C688J35102_120647638	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	1291
3300003319|soilL2_10192229	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1451
3300003320|rootH2_10209568	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2530
3300003322|rootL2_10274474	All Organisms → cellular organisms → Bacteria	1361
3300003324|soilH2_10040440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	5823
3300003324|soilH2_10045056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3250
3300003324|soilH2_10058519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	5226
3300003324|soilH2_10058525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1174
3300003324|soilH2_10124655	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1049
3300003324|soilH2_10216053	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1283
3300003848|Ga0058694_1000811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	14085
3300004016|Ga0058689_10059459	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	728
3300004114|Ga0062593_100251621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1460
3300004114|Ga0062593_102753346	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	560
3300004479|Ga0062595_100006031	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3554
3300004479|Ga0062595_100050995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1893
3300004479|Ga0062595_100239544	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1165
3300004480|Ga0062592_100635322	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	915
3300005093|Ga0062594_100198436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1395
3300005093|Ga0062594_100661200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	932
3300005093|Ga0062594_101215260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	748
3300005093|Ga0062594_102042241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	614
3300005093|Ga0062594_103242432	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	510
3300005171|Ga0066677_10205668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1103
3300005177|Ga0066690_10193605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1351
3300005178|Ga0066688_10010489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	4544
3300005184|Ga0066671_10362421	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	922
3300005184|Ga0066671_10639700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	691
3300005184|Ga0066671_10938527	Not Available	547
3300005186|Ga0066676_10439592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	883
3300005186|Ga0066676_10538795	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	792
3300005327|Ga0070658_10003375	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	13155
3300005327|Ga0070658_10015809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	6034
3300005327|Ga0070658_10083334	All Organisms → cellular organisms → Bacteria → Proteobacteria	2628
3300005327|Ga0070658_10114367	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2237
3300005327|Ga0070658_10143229	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1997
3300005327|Ga0070658_10157937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1901
3300005327|Ga0070658_10293284	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1386
3300005327|Ga0070658_10336022	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1291
3300005327|Ga0070658_10376660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1217
3300005327|Ga0070658_10657592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	909
3300005327|Ga0070658_10908641	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	765
3300005327|Ga0070658_11058090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	706
3300005327|Ga0070658_11574237	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	569
3300005327|Ga0070658_11664542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	552
3300005328|Ga0070676_10061417	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	2234
3300005328|Ga0070676_10228872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1231
3300005328|Ga0070676_10272998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1136
3300005329|Ga0070683_100217672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1815
3300005329|Ga0070683_100510524	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	1149
3300005329|Ga0070683_100689806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	978
3300005329|Ga0070683_101268124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	708
3300005330|Ga0070690_100054076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2570
3300005331|Ga0070670_100036695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	4217
3300005331|Ga0070670_100062360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3201
3300005334|Ga0068869_100203152	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1563
3300005335|Ga0070666_10002660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	10779
3300005335|Ga0070666_10062715	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2519
3300005335|Ga0070666_10343895	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1066
3300005336|Ga0070680_100000414	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	29107
3300005336|Ga0070680_100001419	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	17329
3300005336|Ga0070680_100028798	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	4456
3300005336|Ga0070680_100143543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2002
3300005336|Ga0070680_100254897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1484
3300005336|Ga0070680_100380029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1202
3300005336|Ga0070680_100796860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	814
3300005338|Ga0068868_101041210	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	750
3300005338|Ga0068868_101509749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	629
3300005339|Ga0070660_100041097	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3523
3300005339|Ga0070660_100050663	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	3195
3300005339|Ga0070660_100104890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	2243
3300005339|Ga0070660_100157536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1828
3300005339|Ga0070660_100213147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1568
3300005339|Ga0070660_101163256	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	654
3300005341|Ga0070691_10029150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2582
3300005344|Ga0070661_100042976	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3300
3300005344|Ga0070661_100044190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3255
3300005344|Ga0070661_100083914	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	2353
3300005355|Ga0070671_100081810	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	2700
3300005356|Ga0070674_100125564	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1905
3300005356|Ga0070674_100257413	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	1373
3300005366|Ga0070659_100010221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	6903
3300005366|Ga0070659_100060035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3003
3300005366|Ga0070659_100258355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1445
3300005366|Ga0070659_100502983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1033
3300005366|Ga0070659_100925018	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	763
3300005367|Ga0070667_100221541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1684
3300005367|Ga0070667_102254471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	513
3300005367|Ga0070667_102295850	Not Available	508
3300005434|Ga0070709_10002904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	9240
3300005435|Ga0070714_100121849	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2320
3300005435|Ga0070714_100447542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	1226
3300005435|Ga0070714_101185602	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	745
3300005436|Ga0070713_100277296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1537
3300005436|Ga0070713_100676074	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	985
3300005454|Ga0066687_10761624	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	576
3300005455|Ga0070663_100032397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3602
3300005455|Ga0070663_100640296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	898
3300005455|Ga0070663_100773310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	821
3300005455|Ga0070663_101838916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	543
3300005456|Ga0070678_100030762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3694
3300005457|Ga0070662_100184822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1645
3300005458|Ga0070681_10683553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	942
3300005530|Ga0070679_100569937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1076
3300005530|Ga0070679_101182343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	710
3300005532|Ga0070739_10008391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	10617
3300005535|Ga0070684_100045916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3784
3300005535|Ga0070684_102113829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	531
3300005539|Ga0068853_100587856	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1057
3300005539|Ga0068853_101209625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	729
3300005543|Ga0070672_101702023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	566
3300005544|Ga0070686_100142235	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1671
3300005547|Ga0070693_100420431	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	931
3300005547|Ga0070693_100950083	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	647
3300005547|Ga0070693_100959529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	644
3300005548|Ga0070665_100364729	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1451
3300005548|Ga0070665_100562713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1153
3300005548|Ga0070665_100905076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	895
3300005552|Ga0066701_10702174	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	608
3300005560|Ga0066670_10012755	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3665
3300005563|Ga0068855_100346059	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1638
3300005563|Ga0068855_101793945	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	623
3300005564|Ga0070664_100192018	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1820
3300005564|Ga0070664_100206202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1756
3300005564|Ga0070664_100208461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1746
3300005566|Ga0066693_10287239	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	656
3300005568|Ga0066703_10161277	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	1350
3300005568|Ga0066703_10248527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1080
3300005568|Ga0066703_10417885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	805
3300005568|Ga0066703_10579534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	656
3300005575|Ga0066702_10214030	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1170
3300005575|Ga0066702_10215624	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1166
3300005578|Ga0068854_100895385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	780
3300005578|Ga0068854_101079669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	714
3300005578|Ga0068854_101216063	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	675
3300005614|Ga0068856_100236609	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1842
3300005614|Ga0068856_100311916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1590
3300005614|Ga0068856_100328001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1548
3300005616|Ga0068852_100023492	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	4964
3300005616|Ga0068852_100942818	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	881
3300005616|Ga0068852_102327442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	557
3300005616|Ga0068852_102817244	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	504
3300005616|Ga0068852_102862079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	500
3300005617|Ga0068859_100025180	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	5971
3300005617|Ga0068859_101565234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	728
3300005618|Ga0068864_100314035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1470
3300005618|Ga0068864_100773584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	942
3300005718|Ga0068866_10095541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1628
3300005834|Ga0068851_10019303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	3293
3300005834|Ga0068851_10844148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	571
3300005843|Ga0068860_101788598	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	636
3300005985|Ga0081539_10030554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3341
3300006028|Ga0070717_11245700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	677
3300006034|Ga0066656_10541658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	757
3300006237|Ga0097621_100454069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1155
3300006237|Ga0097621_100874170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	836
3300006237|Ga0097621_101768776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	589
3300006358|Ga0068871_100544799	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1050
3300006606|Ga0074062_12849134	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	664
3300006755|Ga0079222_10087745	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1592
3300006755|Ga0079222_11288216	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	664
3300006755|Ga0079222_11986036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	571
3300006804|Ga0079221_10057070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1773
3300006806|Ga0079220_10119038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1404
3300006852|Ga0075433_11746922	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	535
3300006954|Ga0079219_10101636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1414
3300006954|Ga0079219_10660369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	783
3300006954|Ga0079219_10985897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	696
3300006954|Ga0079219_11029922	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	687
3300009098|Ga0105245_10199255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1922
3300009148|Ga0105243_10035637	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	3859
3300009177|Ga0105248_10005172	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	14385
3300009177|Ga0105248_12997808	Not Available	538
3300009545|Ga0105237_10443627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1304
3300009551|Ga0105238_10818722	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	947
3300009553|Ga0105249_10645084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1116
3300009840|Ga0126313_10055502	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2808
3300010039|Ga0126309_10013452	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	3431
3300010039|Ga0126309_10559272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	713
3300010042|Ga0126314_10338600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1078
3300010152|Ga0126318_10108547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	534
3300010364|Ga0134066_10348798	All Organisms → cellular organisms → Bacteria	548
3300010364|Ga0134066_10425908	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	512
3300010396|Ga0134126_12866285	Not Available	522
3300010401|Ga0134121_12201455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	588
3300012212|Ga0150985_104288919	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	830
3300012212|Ga0150985_105055614	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	531
3300012951|Ga0164300_10740254	All Organisms → cellular organisms → Bacteria → Proteobacteria	601
3300012955|Ga0164298_10374323	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	911
3300012958|Ga0164299_10552329	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	777
3300012960|Ga0164301_10268428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1131
3300012960|Ga0164301_10861490	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	699
3300012977|Ga0134087_10809088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	508
3300012986|Ga0164304_10010616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	4063
3300012986|Ga0164304_10470864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	910
3300012988|Ga0164306_10190973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1430
3300012989|Ga0164305_11359929	Not Available	623
3300013100|Ga0157373_10127453	All Organisms → cellular organisms → Bacteria → Proteobacteria	1790
3300013100|Ga0157373_10323140	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1098
3300013100|Ga0157373_11170529	Not Available	579
3300013100|Ga0157373_11334574	Not Available	544
3300013102|Ga0157371_10201297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1427
3300013102|Ga0157371_11311969	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	560
3300013104|Ga0157370_10506323	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	1109
3300013104|Ga0157370_11405137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	628
3300013105|Ga0157369_10017493	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	8056
3300013105|Ga0157369_10067559	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3842
3300013105|Ga0157369_10156615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	2406
3300013105|Ga0157369_10164230	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2342
3300013105|Ga0157369_12099697	Not Available	573
3300013105|Ga0157369_12111690	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	571
3300013296|Ga0157374_10985545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	862
3300013297|Ga0157378_10859557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	936
3300013297|Ga0157378_11670107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	684
3300013308|Ga0157375_10868374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1048
3300013308|Ga0157375_11711878	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	745
3300013308|Ga0157375_12949450	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	568
3300014166|Ga0134079_10057615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1385
3300014326|Ga0157380_11499525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	727
3300014497|Ga0182008_10160911	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	1130
3300015195|Ga0167658_1008997	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3160
3300015371|Ga0132258_10257072	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	4273
3300015371|Ga0132258_11480478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1715
3300015373|Ga0132257_101988836	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	749
3300015374|Ga0132255_102358533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	812
3300017792|Ga0163161_11405026	Not Available	610
3300018433|Ga0066667_11407944	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	612
3300018468|Ga0066662_10045599	All Organisms → cellular organisms → Bacteria	2751
3300018468|Ga0066662_10310515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1331
3300018468|Ga0066662_10325873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1306
3300018468|Ga0066662_10392039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	1216
3300018468|Ga0066662_10960031	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	844
3300018468|Ga0066662_10969777	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	840
3300018468|Ga0066662_12355139	Not Available	560
3300018482|Ga0066669_11691749	Not Available	580
3300020069|Ga0197907_10381689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	2250
3300020070|Ga0206356_10782859	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1164
3300020078|Ga0206352_11047594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	639
3300020081|Ga0206354_10139356	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1864
3300020081|Ga0206354_10390723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	566
3300020082|Ga0206353_10753494	Not Available	645
3300020082|Ga0206353_11281196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1813
3300020215|Ga0196963_10502693	Not Available	549
3300021339|Ga0193706_1010021	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3295
3300021362|Ga0213882_10294751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	676
3300021445|Ga0182009_10012840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2966
3300021445|Ga0182009_10145079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1123
3300021445|Ga0182009_10179301	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1021
3300021445|Ga0182009_10472481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	658
3300025271|Ga0207666_1057367	All Organisms → cellular organisms → Bacteria	621
3300025315|Ga0207697_10005369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	5959
3300025315|Ga0207697_10008269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4567
3300025315|Ga0207697_10058868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1596
3300025315|Ga0207697_10470552	Not Available	556
3300025321|Ga0207656_10032597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2165
3300025321|Ga0207656_10067003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	1588
3300025321|Ga0207656_10092706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1373
3300025321|Ga0207656_10287948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	811
3300025893|Ga0207682_10066282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1522
3300025899|Ga0207642_10025305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2399
3300025899|Ga0207642_10031064	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	2233
3300025901|Ga0207688_10154458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1358
3300025903|Ga0207680_10002682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	8317
3300025903|Ga0207680_10013081	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	4249
3300025903|Ga0207680_10041224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2692
3300025903|Ga0207680_10319626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	1085
3300025904|Ga0207647_10010461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	6554
3300025904|Ga0207647_10022188	All Organisms → cellular organisms → Bacteria	4223
3300025904|Ga0207647_10209145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1127
3300025904|Ga0207647_10246933	Not Available	1024
3300025904|Ga0207647_10311307	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	895
3300025904|Ga0207647_10428036	Not Available	743
3300025907|Ga0207645_10618635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	735
3300025909|Ga0207705_10001794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	16918
3300025909|Ga0207705_10014461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	5681
3300025909|Ga0207705_10033029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3698
3300025909|Ga0207705_10050323	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2999
3300025909|Ga0207705_10072589	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2496
3300025909|Ga0207705_10100806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	2124
3300025909|Ga0207705_10128547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1884
3300025909|Ga0207705_10558957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	889
3300025909|Ga0207705_10796746	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	733
3300025909|Ga0207705_11140394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	600
3300025909|Ga0207705_11189069	Not Available	585
3300025909|Ga0207705_11350222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	543
3300025912|Ga0207707_10031881	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	4614
3300025912|Ga0207707_10355981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1261
3300025913|Ga0207695_10345534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1375
3300025916|Ga0207663_11723219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	504
3300025917|Ga0207660_10000159	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	42039
3300025917|Ga0207660_10000329	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	30623
3300025917|Ga0207660_11075572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	656
3300025918|Ga0207662_10752307	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	685
3300025919|Ga0207657_10003595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	16527
3300025919|Ga0207657_10010394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	9290
3300025919|Ga0207657_10012447	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	8402
3300025919|Ga0207657_10157379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1847
3300025919|Ga0207657_10316052	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1235
3300025919|Ga0207657_10665726	All Organisms → cellular organisms → Bacteria → Proteobacteria	810
3300025920|Ga0207649_10043590	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Allosphingosinicella → Allosphingosinicella indica	2744
3300025920|Ga0207649_10055554	All Organisms → cellular organisms → Bacteria	2469
3300025920|Ga0207649_11486785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	536
3300025921|Ga0207652_10258990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	1569
3300025921|Ga0207652_11287197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	634
3300025921|Ga0207652_11828960	Not Available	512
3300025924|Ga0207694_10419338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	1115
3300025924|Ga0207694_11262884	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	625
3300025925|Ga0207650_10081726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2451
3300025928|Ga0207700_11181321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	683
3300025929|Ga0207664_10642716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	953
3300025929|Ga0207664_11213212	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	673
3300025931|Ga0207644_11605688	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	545
3300025932|Ga0207690_10038019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3129
3300025932|Ga0207690_10157568	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1689
3300025932|Ga0207690_10694196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	836
3300025932|Ga0207690_10813150	Not Available	773
3300025932|Ga0207690_11073689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	671
3300025932|Ga0207690_11147905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	648
3300025932|Ga0207690_11203992	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	632
3300025933|Ga0207706_10014599	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	7113
3300025933|Ga0207706_10469743	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1087
3300025933|Ga0207706_11386234	All Organisms → cellular organisms → Bacteria	578
3300025933|Ga0207706_11591757	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	530
3300025935|Ga0207709_11730858	Not Available	520
3300025936|Ga0207670_10092006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2146
3300025937|Ga0207669_10005310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	5767
3300025937|Ga0207669_10046265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Allosphingosinicella → Allosphingosinicella indica	2570
3300025937|Ga0207669_10047527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2543
3300025937|Ga0207669_10129970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1728
3300025937|Ga0207669_11372262	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	601
3300025938|Ga0207704_10120916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	1792
3300025942|Ga0207689_10760949	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	817
3300025945|Ga0207679_10035051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3547
3300025945|Ga0207679_10322994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	1337
3300025949|Ga0207667_10095231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3074
3300025961|Ga0207712_10529570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1011
3300025981|Ga0207640_10159979	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1665
3300025986|Ga0207658_10945926	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	785
3300026041|Ga0207639_10361731	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1299
3300026041|Ga0207639_10822725	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	866
3300026067|Ga0207678_10229559	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1589
3300026095|Ga0207676_10263345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1558
3300026116|Ga0207674_10026970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	6090
3300026142|Ga0207698_10322197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1448
3300026142|Ga0207698_10464283	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220	1225
3300026142|Ga0207698_12278166	Not Available	554
3300026142|Ga0207698_12716767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	504
3300026319|Ga0209647_1046600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2371
3300026324|Ga0209470_1104920	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	1266
3300026324|Ga0209470_1258748	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	692
3300026331|Ga0209267_1026214	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2848
3300026529|Ga0209806_1145668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	911
3300027725|Ga0209178_1414251	Not Available	514
3300027750|Ga0209461_10158419	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium	555
3300027766|Ga0209796_10005601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	4173
3300027766|Ga0209796_10014381	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2429
3300027766|Ga0209796_10014661	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2401
3300027766|Ga0209796_10035607	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1494
3300027766|Ga0209796_10045554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1318
3300027766|Ga0209796_10067302	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1085
3300027766|Ga0209796_10082051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	984
3300027773|Ga0209810_1020465	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	4337
3300028041|Ga0247719_1002682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	6488
3300028379|Ga0268266_10021287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	5524
3300028379|Ga0268266_10893652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	859
3300028379|Ga0268266_11038887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	793
3300030496|Ga0268240_10110510	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	651
3300030511|Ga0268241_10030060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1103
3300031548|Ga0307408_100885605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	816
3300031716|Ga0310813_10998685	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	763
3300031731|Ga0307405_10079180	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2141
3300031731|Ga0307405_10083071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2098
3300031938|Ga0308175_100011052	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	6794
3300031938|Ga0308175_100055077	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	3461
3300031938|Ga0308175_100080909	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2928
3300031938|Ga0308175_100127526	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	2400
3300031938|Ga0308175_100146816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	2256
3300031938|Ga0308175_100236990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1822
3300031938|Ga0308175_100338586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1549
3300031938|Ga0308175_100382173	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1465
3300031938|Ga0308175_100405136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1426
3300031938|Ga0308175_100653091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1137
3300031938|Ga0308175_100822197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1018
3300031938|Ga0308175_101134086	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	868
3300031938|Ga0308175_101183481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	849
3300031938|Ga0308175_101211011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	840
3300031938|Ga0308175_101497200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	754
3300031938|Ga0308175_102364343	Not Available	595
3300031938|Ga0308175_102506801	Not Available	578
3300031938|Ga0308175_102813284	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	543
3300031939|Ga0308174_10195562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1539
3300031939|Ga0308174_10254470	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1366
3300031939|Ga0308174_10435236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1062
3300031939|Ga0308174_11065954	Not Available	687
3300031939|Ga0308174_11584392	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	562
3300031939|Ga0308174_11780688	Not Available	529
3300031995|Ga0307409_100412531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1293
3300031996|Ga0308176_10664326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1078
3300031996|Ga0308176_11633022	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	687
3300031996|Ga0308176_12823037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	516
3300032002|Ga0307416_102189110	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	654
3300032002|Ga0307416_103364982	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	535
3300032003|Ga0310897_10067652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli	1340
3300032074|Ga0308173_10110504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2157
3300032074|Ga0308173_10467849	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	1123
3300032080|Ga0326721_10711549	Not Available	622
3300034135|Ga0334929_046803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	897
3300034268|Ga0372943_0044846	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	2452
3300034268|Ga0372943_0787501	Not Available	630

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	55.79%
Environmental	Environmental	44.21%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	55.79%
Terrestrial	Environmental → Terrestrial	43.97%
Aquatic	Environmental → Aquatic	0.24%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	43.74%
Rhizosphere	Host-Associated → Plants → Rhizosphere	35.22%
Rhizoplane	Host-Associated → Plants → Rhizoplane	16.78%
Phylloplane	Host-Associated → Plants → Phylloplane	1.89%
Roots	Host-Associated → Plants → Roots	0.95%
Rhizome	Host-Associated → Plants → Rhizome	0.47%
Phyllosphere	Host-Associated → Plants → Phyllosphere	0.47%
Freshwater	Environmental → Aquatic → Freshwater	0.24%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	0.24%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	31.91%
Soil	Host-Associated → Plants → Rhizosphere → Soil	25.30%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	15.13%
Loam	Environmental → Terrestrial → Soil → Loam	11.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.93%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	1.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.42%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.95%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified	0.47%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	0.47%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.24%
Soil Crust	Environmental → Terrestrial → Soil → Soil Crust	0.24%
Sand	Environmental → Terrestrial → Soil → Sand	0.24%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	0.24%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.24%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	25.30%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	15.13%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	10.40%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	10.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.93%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.56%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	7.09%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.62%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	1.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.42%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.95%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.95%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.47%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified → Unclassified	0.47%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	0.47%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.24%
Unclassified	Environmental → Terrestrial → Soil → Soil Crust → Unclassified	0.24%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.24%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	0.24%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.24%

Habitat

Habitat	Taxonomy	Distribution
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	17.02%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	9.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	7.09%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	5.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.20%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.20%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.07%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.60%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.60%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.36%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.13%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.89%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	1.89%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	1.65%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.42%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.42%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.42%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.42%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.18%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.95%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.95%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.95%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.95%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.95%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.95%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.95%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.71%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.47%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.47%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.47%
Sugarcane Root And Bulk Soil	Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil	0.47%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	0.47%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.24%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.24%
Hypolithic Biocrust	Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust	0.24%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.24%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	0.24%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.24%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.24%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.24%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.24%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.24%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2199352024	Bare-fallow DEEP SOIL	Environmental
3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Host-Associated
3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Host-Associated
3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Host-Associated
3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Host-Associated
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental
3300003319	Sugarcane bulk soil Sample L2	Environmental
3300003320	Sugarcane root Sample H2	Host-Associated
3300003322	Sugarcane root Sample L2	Host-Associated
3300003324	Sugarcane bulk soil Sample H2	Environmental
3300003848	Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz	Host-Associated
3300004016	Agave microbial communities from Guanajuato, Mexico - As.Ma.rz	Host-Associated
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental
3300005532	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1	Environmental
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental
3300010152	Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)	Environmental
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated
3300015195	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental
3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)	Environmental
3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)	Environmental
3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)	Environmental
3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)	Environmental
3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)	Environmental
3300020215	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5	Environmental
3300021339	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1	Environmental
3300021362	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09	Environmental
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental
3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)	Environmental
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental
3300026331	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)	Environmental
3300026529	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)	Environmental
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental
3300027750	Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)	Host-Associated
3300027766	Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes)	Host-Associated
3300027773	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)	Environmental
3300028041	Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-1-E_D	Environmental
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300030496	Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)	Environmental
3300030511	Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)	Environmental
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental
3300032080	Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016	Environmental
3300034135	Biocrust microbial communities from Mojave Desert, California, United States - 25HNC	Environmental
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
deeps_03556500	2199352024	Soil	MAERDDANELSWPWWAPWALLAVAVTSLLTIGATLYDIL
deeps_01143860	2199352024	Soil	MTLRQSAAMAKLDDTYKLSWPWWALLAVVATAALTIAATLYDIL
JGI24740J21852_100481442	3300001979	Corn Rhizosphere	MAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYXIL*
JGI24740J21852_101825382	3300001979	Corn Rhizosphere	PEETRELSWPWWSSWALLAVAVTSVLTIAATLYDIL*
JGI24739J22299_101888012	3300001989	Corn Rhizosphere	MAQPHDTNQLSWPWWAPWALLAVAVTSVLTIGATL*
JGI24743J22301_100501302	3300001991	Corn, Switchgrass And Miscanthus Rhizosphere	MQERDDTNRLSWPXWAPWALLAVAITSVLTIGATLYDIL*
JGI24735J21928_101916881	3300002067	Corn Rhizosphere	MTERNETEKLSWPWWAPWALLAVAATSVLTVAATLY
C688J35102_1184604312	3300002568	Soil	MANPDEANELSWPWWAPWALLAVAATSLLTIGATLYDIL*
C688J35102_1194439381	3300002568	Soil	AVAKMDKTHRLSWPGWAPWALLAVAATSVLTVAATLYDIL*
C688J35102_1206476382	3300002568	Soil	MAKSDDANRLSWPWWAPWTLIAVAATSLLTIAATLYDIL*
soilL2_101922292	3300003319	Sugarcane Root And Bulk Soil	MPQPHDTNELSWPWWAPWALLAVAATSLLTIAATLYDIL*
rootH2_102095682	3300003320	Sugarcane Root And Bulk Soil	MAKSADPQRLSWPWWAPWALLAVVITSLLTIAATLYDIL*
rootL2_102744742	3300003322	Sugarcane Root And Bulk Soil	MASPQETKKLSWPWWAPWALLAIAATSLLTIAATLYDIL*
soilH2_100404403	3300003324	Sugarcane Root And Bulk Soil	MADQDETTKLSWPWWAPWALLAVAATSVLTVAATFYDIL*
soilH2_100450562	3300003324	Sugarcane Root And Bulk Soil	MAKRDETTRLSWPWWAPWALLAVALTSLLTIAATLYDIR*
soilH2_100585199	3300003324	Sugarcane Root And Bulk Soil	MAKSGDTQKLSWPWWAPWALLAVAATSLLTIAATLYDIL*
soilH2_100585252	3300003324	Sugarcane Root And Bulk Soil	MSQKEKTYELSWPWWAPWALLAVAITSLLTIAATLYDIR*
soilH2_101246552	3300003324	Sugarcane Root And Bulk Soil	MAKKDATHKLSWPWWASWALLAVAATSVLTIAATFYDIL*
soilH2_102160532	3300003324	Sugarcane Root And Bulk Soil	MSKANETTKLSWPWWAPWALLAVAAASLLTVAATLYDIL*
Ga0058694_10008115	3300003848	Agave	MAKRDETNALSWPWWAPWALLAVAATSLLTVWVTLNDIL*
Ga0058689_100594592	3300004016	Agave	MAERDETHQLSWPWWAPWALLAVALTSVLTVAVTLRDIL*
Ga0062593_1002516212	3300004114	Soil	MAQREERTHRLSWPWWASWALLAIAATSLLTIAVTLNDIL*
Ga0062593_1027533462	3300004114	Soil	DMANSDEANRLSWPWWAPWALLAVIATSALTIAATLYDIL*
Ga0062595_1000060312	3300004479	Soil	MTDRNETHKLSWPWWAPWALLAVAVTSVLTIAATLYDIL*
Ga0062595_1000509952	3300004479	Soil	MAERDDAEELSWPGWASWALLAVALTSVLTIGATLYDIL*
Ga0062595_1002395442	3300004479	Soil	MAQKDEVKKLSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0062592_1006353222	3300004480	Soil	MAQREERTHRLSWPWWASWALLAVAATSLLTIAVTLNDIL*
Ga0062594_1001984362	3300005093	Soil	MAEFDERKRLSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0062594_1006612002	3300005093	Soil	MSQMTDETRKLSWPWWASWVLLTVAATCVLTVAATLYDIL*
Ga0062594_1012152602	3300005093	Soil	MAERDDAEELSWPGWASWALLAVALTSVLTIGATLYDVL*
Ga0062594_1020422411	3300005093	Soil	MANSEEAKRLSWPWWAPWALLGVAATSLLTVAATLYDIL*
Ga0062594_1032424322	3300005093	Soil	MAERDDLDGLSWPWWSPWALLAVAVTSLLTIGAALHDIL*
Ga0066677_102056682	3300005171	Soil	VANVQENKKLSWPWWAPWTLLAVAATSLLTIAATLYDIL*
Ga0066690_101936052	3300005177	Soil	MAKLDETERLSWPWWAPWALLAVAATSLLTIGATLYDIL*
Ga0066688_100104894	3300005178	Soil	MPKHDEAQKLSWPWWAPWALVAVAVTSVLTIAATLDDIL*
Ga0066671_103624212	3300005184	Soil	MTNVRDKANTLAWPWWASWALLAVAATSVLTVAATLYDIL*
Ga0066671_106397002	3300005184	Soil	MAKQTDEIQKLSWPWWASWALLAVAATSVLTVAATLYDIL*
Ga0066671_109385271	3300005184	Soil	MARADETKKLSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0066676_104395922	3300005186	Soil	MTKSDETHELSWPWWAPWALIAVAVTSLLTVGAALYDIL*
Ga0066676_105387952	3300005186	Soil	MAKFDEANELSWPWWAPWALLAVAATSLLTIGATLYDIL*
Ga0070658_100033756	3300005327	Corn Rhizosphere	VQDLPMAKMDETDRLSWPGWAPWALLAVAVTSLLTIAATLYDIL*
Ga0070658_100158092	3300005327	Corn Rhizosphere	MMAKQDETNRLSWPWWAPWALLAVALSSLLTIAATLYDIR*
Ga0070658_100833343	3300005327	Corn Rhizosphere	MANPEETNELSWPSWAPWALFAVAATSLLTIGATLYDIL*
Ga0070658_101143672	3300005327	Corn Rhizosphere	MAKRDETDRLSWPWWAPWALLGVAATSLLTIAATLHDIL*
Ga0070658_101432292	3300005327	Corn Rhizosphere	MAKMDETHRLSWPWWASWALLAVAVTCALTVAATLYDIL*
Ga0070658_101579372	3300005327	Corn Rhizosphere	MPKLDETHRLSWPWWAPWALLAVAATSLLTVAATLNDIL*
Ga0070658_102932842	3300005327	Corn Rhizosphere	MQERDDTNRLSWPLWAPWALLAVAITSVLTIGATLYDIL*
Ga0070658_103360222	3300005327	Corn Rhizosphere	MAKLDETERLSWPWWAPWALLAVVLTSILTIGATLYDIL*
Ga0070658_103766601	3300005327	Corn Rhizosphere	MAHSDEAPKIPWPWWSTWALVAVVATSILTIAATLYDIL*
Ga0070658_106575923	3300005327	Corn Rhizosphere	LAWLRIVAAMAKWDETTRLAWPWWAPWALLAVAVTSLLTIAATLNDIL*
Ga0070658_109086411	3300005327	Corn Rhizosphere	MAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL*
Ga0070658_110580902	3300005327	Corn Rhizosphere	MAKRDETTRLAWPWWAPWALLGVAVTSLLTIAATLNDIL*
Ga0070658_115742372	3300005327	Corn Rhizosphere	GKESAMAKSDEARRLSWPWWAPWALLAVILTSILTVGATLYDIL*
Ga0070658_116645422	3300005327	Corn Rhizosphere	MTPNDEVHKLPWPWWATWVLLAVVLTSLLTIGATLFDFL*
Ga0070676_100614172	3300005328	Miscanthus Rhizosphere	MAERDDANELSWPWWAPWALIAVAATSLLTIGATLYDIL*
Ga0070676_102288722	3300005328	Miscanthus Rhizosphere	MAQPHDTNQLSWPWWAPWALLAVAVTSVLTIGATLYDIL*
Ga0070676_102729982	3300005328	Miscanthus Rhizosphere	MSKPIETDALSWTSWAPWTLLVVDATPVLMVGATLYDIL*
Ga0070683_1002176722	3300005329	Corn Rhizosphere	MAKRDETQRLSWPWWAPWALLAVAATSLLTIAVTLNDIL*
Ga0070683_1005105242	3300005329	Corn Rhizosphere	MAKSDEARRLSWPWWAPWALLAVILTSILTVGATLYDIL*
Ga0070683_1006898062	3300005329	Corn Rhizosphere	MAKLDETHRLSWPRWAPWALLAVVLTSILTIGATLYDIL*
Ga0070683_1012681241	3300005329	Corn Rhizosphere	MAQRDETRRLSWPWWAPWALLGVAATSLLTIAVTLNDIL*
Ga0070690_1000540762	3300005330	Switchgrass Rhizosphere	MASSQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0070670_1000366952	3300005331	Switchgrass Rhizosphere	MAQQHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIR*
Ga0070670_1000623602	3300005331	Switchgrass Rhizosphere	VSERFPMADQDKANQLSWPWWAPWALLAVALTSVLTIGATLYDIL*
Ga0068869_1002031522	3300005334	Miscanthus Rhizosphere	MAQPHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIL*
Ga0070666_100026603	3300005335	Switchgrass Rhizosphere	MARSQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0070666_100627152	3300005335	Switchgrass Rhizosphere	MAQQHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIL*
Ga0070666_103438952	3300005335	Switchgrass Rhizosphere	VAKSDETNRLSWPWWAPWAVLAVAATSVLTVAATLYDIL*
Ga0070680_1000004143	3300005336	Corn Rhizosphere	MAKHDATHKLAWPWWSPWALLAVVVTSLLTIAATLNDIL*
Ga0070680_1000014194	3300005336	Corn Rhizosphere	MAKQDETHKLAWPWWAPWALLAVVATSLLTIAATLNDIL*
Ga0070680_1000287982	3300005336	Corn Rhizosphere	MAKQDATHKLAWPWWSPWALIAVVVTSLLTIAATLNDIL*
Ga0070680_1001435431	3300005336	Corn Rhizosphere	MSQREKTNELSWPWWAPWALLAVAVTSLLTIAATLYDIR*
Ga0070680_1002548972	3300005336	Corn Rhizosphere	MAKLDETERLSWPWWASWALLAVVLTSILTIGATLYDIL*
Ga0070680_1003800291	3300005336	Corn Rhizosphere	CGKESAMAKSDEARRLSWPWWAPWALLAVILTSILTVGATLYDIL*
Ga0070680_1007968602	3300005336	Corn Rhizosphere	MAKQDATHKLAWPWWAPWALLAVVVTSLLTIAATLNDIL*
Ga0068868_1010412102	3300005338	Miscanthus Rhizosphere	GQACRYMAQQHDTNELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0068868_1015097492	3300005338	Miscanthus Rhizosphere	MTPNDEVHKLPWPWWATWVLLAVVLTSLLTIGATLFDIL*
Ga0070660_1000410973	3300005339	Corn Rhizosphere	MAEQDETNKLSWPWWAPWALLAVALSSLLTIAATLYDVR*
Ga0070660_1000506634	3300005339	Corn Rhizosphere	MAKPNEAKSLSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0070660_1001048903	3300005339	Corn Rhizosphere	MPERDDIRELSWPWWAPWALLAVAVTSVLTVAVTLRDIL*
Ga0070660_1001575362	3300005339	Corn Rhizosphere	MAKLDETHRLSWPWWAPWALLAVVLTSILTIGATLYDIL*
Ga0070660_1002131472	3300005339	Corn Rhizosphere	MSQREKTNELSWPWWAPWALLAVAITSLLTIAATLYDIR*
Ga0070660_1011632561	3300005339	Corn Rhizosphere	MAKRDETTRLSWPWWAPWALLAVALASLLTIAATLYDIR*
Ga0070691_100291502	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	MAEQDETNKLSWPWWAPWALLAVALSSLLTIAATLYDIR*
Ga0070661_1000429763	3300005344	Corn Rhizosphere	MAQQHDTNELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0070661_1000441901	3300005344	Corn Rhizosphere	MPKPIETDALSWPWWAPWALLVVAATPVLMVGATLYDTL*
Ga0070661_1000839142	3300005344	Corn Rhizosphere	MAERDDLDGLSWPWWSPWALLAVAATSLLTIGAALHDIL*
Ga0070692_103083641	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	PSPGGWSAGLKPRGAMAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL*
Ga0070671_1000818104	3300005355	Switchgrass Rhizosphere	FAMAQKDEVKKLSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0070674_1001255642	3300005356	Miscanthus Rhizosphere	MAERDDANELSWPWWASWALLAVALTSVLTIGATLYDIL*
Ga0070674_1002574132	3300005356	Miscanthus Rhizosphere	VRQANDMASKQDKKLSGPRWAPRALLAVAATSVLTVAATLYD
Ga0070659_1000102212	3300005366	Corn Rhizosphere	MANSDEANRLSWPWWAPWALLAVIATSALTIAATLYDIL*
Ga0070659_1000600352	3300005366	Corn Rhizosphere	MPERDDIRELSWPWWAPWALFAVAVTSVLTVAVTLRDIL*
Ga0070659_1002583551	3300005366	Corn Rhizosphere	CSTRGLKMAERDDAEELSWPGWASWALLAVALTSVLTIGATLYDIL*
Ga0070659_1005029832	3300005366	Corn Rhizosphere	MAKQDATHKLAWPWWAPWTLLAVVVTSLLTIAATLNDIL*
Ga0070659_1009250182	3300005366	Corn Rhizosphere	MAEQDKANRLSWPWWAPWALLAVALTSVLTIGATLYDIL*
Ga0070667_1002215412	3300005367	Switchgrass Rhizosphere	MQERDDTNRLSWPWWAPWALLAVAITSVLTIGATLYDIL*
Ga0070667_1022544712	3300005367	Switchgrass Rhizosphere	MTPNDEVHKLPWPWWATWVLLAIVLTSLLTIGATLYDIL*
Ga0070667_1022958501	3300005367	Switchgrass Rhizosphere	MSKPIETDALSWPWWAPWALLVVAATPVLTVGATLYDTL*
Ga0070709_100029044	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MAKPDEINELSWPRWAPWALLAVAATSALTIGATLYDIL*
Ga0070714_1001218492	3300005435	Agricultural Soil	MAERDKTHELSWPWWAPWALLGVALTSLLTVGATLYDII*
Ga0070714_1004475422	3300005435	Agricultural Soil	MAKHDEAKSLSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0070714_1011856022	3300005435	Agricultural Soil	MAKQDSTHKLAWPWWSAWALGAVIVTSLLTIAATLNDIL*
Ga0070713_1002772962	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MAKMDETHRLSWPWWAPWALLAVALTSVLTIAATLYDIL*
Ga0070713_1006760742	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MAKPDEIKSLSWPWWGPWALLGVVVTLIATIAATLYDIL*
Ga0066687_107616241	3300005454	Soil	ACSAVAKSDETQELSWPWWAPWALLAVAATSLLTIAATLYDIL*
Ga0070663_1000323972	3300005455	Corn Rhizosphere	MANPEEIHELSWPWWSSWALLAVAVTSVLTIAATLYDIL*
Ga0070663_1006402961	3300005455	Corn Rhizosphere	MSKPIETDALSWTSWAPWTLLVVDATPVRMVGATLYDIL*
Ga0070663_1007733102	3300005455	Corn Rhizosphere	GAMAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL*
Ga0070663_1018389161	3300005455	Corn Rhizosphere	MAKLDETHRLSWPWWAPWALLAVAATCLLTVAATLNDIL*
Ga0070678_1000307622	3300005456	Miscanthus Rhizosphere	MAKSDEIDALSWPWWVPRSVLAVAATSVLTVAAALYDIL*
Ga0070662_1001848222	3300005457	Corn Rhizosphere	MAEQDETNKLSWPWWAPWALLAVALSSLLIIAATLYDIR*
Ga0070681_106835532	3300005458	Corn Rhizosphere	TAVAKMDETRRLSWPWWSSWALLAVAATSVLTIAATLYDIL*
Ga0070679_1005699372	3300005530	Corn Rhizosphere	MAQRDETRRLSWPWWAPWALLAVAATCLLTIAVTLNDIL*
Ga0070679_1011823431	3300005530	Corn Rhizosphere	VAKHEETQRLSWPWWAPWALLAVAATSLLTIAATLNDIL*
Ga0070739_100083913	3300005532	Surface Soil	MAKMDETHRLSWPWWAPWALLGVAVTSALTIAATLYDIL*
Ga0070684_1000459162	3300005535	Corn Rhizosphere	MANPEETRELSWPWWSSWALLAVAVTSVLTIAATLYDIL*
Ga0070684_1021138291	3300005535	Corn Rhizosphere	MLLSAMAKSADPQRLSWPWWAPWALLGVAVTSLLTIAATLYDIL*
Ga0068853_1005878562	3300005539	Corn Rhizosphere	MAKRDETQRLSWPWWAPWALLAVAATSLLTIATTLNDIL*
Ga0068853_1012096252	3300005539	Corn Rhizosphere	MTDRNETHKLSWPWWAPWALLAVAATSVLTVAATLYDIL*
Ga0070672_1017020232	3300005543	Miscanthus Rhizosphere	MEDSDLQKLSWPWWAPWALVAVIVGSALTIAATLYDIL*
Ga0070686_1001422351	3300005544	Switchgrass Rhizosphere	NGMARSQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0070693_1004204312	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MSQREKTNELSWPWWALWALLAVAITSLLTIAATLYDIR*
Ga0070693_1009500831	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MANQEEIHELSWPWWSSWALLAVAVTSVLTIAATLYDIL*
Ga0070693_1009595292	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MEKRQETRRLSWPGWATWALLAVLATSAATIAATLYDIL*
Ga0070665_1003647292	3300005548	Switchgrass Rhizosphere	MAKMTDETRKLSWPWWAPWTLLAVVATSVLTVAATLYDIL*
Ga0070665_1005627132	3300005548	Switchgrass Rhizosphere	VTNDDDAHRMSWPWWAPWALLAVVLSCVATVAATLYDIW*
Ga0070665_1009050762	3300005548	Switchgrass Rhizosphere	MAKSANQRLSWPWWAPWALLAVVATSLLTVAATLYDII*
Ga0066701_107021741	3300005552	Soil	MTNVRDKANTLAWPWWASWALLAVAATSVLTVAATLYDIL
Ga0066670_100127552	3300005560	Soil	MAKPDETNELSWPWWAPWALLAVAATSALTIGATLYDIL*
Ga0068855_1003460591	3300005563	Corn Rhizosphere	VRALSRAMPKLDETHRLSWPWWAPWALLAVAATSLLTVAATLSDIL*
Ga0068855_1017939451	3300005563	Corn Rhizosphere	MAKMDETHRLSWPWWSAWALLAVAVTSVLTIAATLYDIL*
Ga0070664_1001920182	3300005564	Corn Rhizosphere	MSQREKTNELSWPWWALLAVAITSLLTIAATLYDIR*
Ga0070664_1002062022	3300005564	Corn Rhizosphere	MADQDKANQLSWPWWAPWALLAVALTSVLTIGATLYDIL*
Ga0070664_1002084612	3300005564	Corn Rhizosphere	NEAKSLSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0066693_102872392	3300005566	Soil	MTKLDESTKLSWPWWSSWALLAVAATSVLTVAATLYDIL*
Ga0066703_101612772	3300005568	Soil	MTKLDETHELSWPWWAPWALLAVALTSLLTVGAALYDIL*
Ga0066703_102485272	3300005568	Soil	MAERDDANELSWPWWAPWGLLAVAVTSLLTIGATLYDIL*
Ga0066703_104178851	3300005568	Soil	MAKPDETNELSWPCWAPWALLAVAATSLLTIGATLYDIL*
Ga0066703_105795342	3300005568	Soil	MAKFDEANELSWPWWATWALLAVAATSLLTIGATLYDIL*
Ga0066702_102140302	3300005575	Soil	MESRDETRRLSWPWWANWALLAVIVTSLVTIAATLYDIL*
Ga0066702_102156242	3300005575	Soil	MAKPDETNELSWPWWAPWALLAVAATSLLTIGATLYDIL*
Ga0068854_1008953852	3300005578	Corn Rhizosphere	DEVHKLPWPWWATWVLLAIVLTSLLTIGATLYDIL*
Ga0068854_1010796692	3300005578	Corn Rhizosphere	TMAERDDLDGLSWPWWSPWALLAVAVTSLLTIGAALHDIL*
Ga0068854_1012160631	3300005578	Corn Rhizosphere	MTEPDATHELSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0068856_1002366092	3300005614	Corn Rhizosphere	MAKQQDETHKLSWPWWAPWALLAVVVTSLLTVAATLRDIL*
Ga0068856_1003119162	3300005614	Corn Rhizosphere	MAKLDETHRLSRPWWAPWALLAVAATCLLTVAATLNDIL*
Ga0068856_1003280013	3300005614	Corn Rhizosphere	MAERDETRALSWPWWAPWALLGVAATSLLTVAATLKDIL*
Ga0068852_1000234923	3300005616	Corn Rhizosphere	MAQPHDTNELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0068852_1009428181	3300005616	Corn Rhizosphere	VRQASDMASKQETKKLSWPRWAPWALLAVAATSVLTVAAT
Ga0068852_1023274422	3300005616	Corn Rhizosphere	MAKQDETTRLSWPWWASWALLAVAVTSLLTIAATLYDIR*
Ga0068852_1028172442	3300005616	Corn Rhizosphere	ATHELSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0068852_1028620792	3300005616	Corn Rhizosphere	MPVRDEIRELSWPWWAPWALLAVALTSLLTVAVTLRDIL*
Ga0068859_1000251801	3300005617	Switchgrass Rhizosphere	MAKQDEVHKLSWPGWAPWALLAVAATSLLTIAATL
Ga0068859_1015652342	3300005617	Switchgrass Rhizosphere	MTDETRKLSWPWWASWVLLTVAATCVLTVAATLYDIL*
Ga0068864_1003140351	3300005618	Switchgrass Rhizosphere	GQACRYMAQQHDTNELSWPWWAPWALLAVAATSVLTIGATLYDIR*
Ga0068864_1007735842	3300005618	Switchgrass Rhizosphere	MPEMTDETRKLSWPWWAPWALLAVAATSVLTVAATLYDIL*
Ga0068866_100955411	3300005718	Miscanthus Rhizosphere	MASAQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0068851_100193034	3300005834	Corn Rhizosphere	MDETNRLSWPWWAPWALLAVASTSVLTIAATLYDIL*
Ga0068851_108441481	3300005834	Corn Rhizosphere	MAQQDETHKLSWPWWAPWALVIVVVTSLLTIAATLNDIL*
Ga0068860_1017885982	3300005843	Switchgrass Rhizosphere	MATPQETKKLSWPWWAPWALLAVAATSVLTIAATLY
Ga0081539_100305543	3300005985	Tabebuia Heterophylla Rhizosphere	MAKQDETTKLSWPWWAPWALLAVAVTSVLTVGAALYDIL*
Ga0070717_112457001	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MAKPDEIKSLSWPWWGPWALLGVVVTLIATIAATLYDI
Ga0066656_105416581	3300006034	Soil	MAKPDETNDLSWPWWAPWALLAVAATSALTIGATLYDIL
Ga0097621_1004540692	3300006237	Miscanthus Rhizosphere	MSRTDPKRLSWPWWASWALFGVALTSLLTIAATLNDIL*
Ga0097621_1008741702	3300006237	Miscanthus Rhizosphere	MANPQETKKLSWPWWAPWALLAVAATSVLTIAATLYDIL*
Ga0097621_1017687762	3300006237	Miscanthus Rhizosphere	MAKMDETHRLSWPWWAPWALLGVAVTSVLTIAATLY
Ga0068871_1005447992	3300006358	Miscanthus Rhizosphere	SRTDPKRLSWPWWASWALFGVALTSLLTIAATLNDIL*
Ga0074062_128491342	3300006606	Soil	MAEMDKTHELSWPWWAPWALLAVAATSILTIAATLYDNL*
Ga0079222_100877452	3300006755	Agricultural Soil	MSKEAKTNELSWPWWAPWALLAVALTSLLTIAATLYDIR*
Ga0079222_112882162	3300006755	Agricultural Soil	MTPRDEVEKLPWPWWATWALLAVVVTSLLTIAATLYDIL*
Ga0079222_119860362	3300006755	Agricultural Soil	MPCGKAFGLMAEMDETHRLSWPWWGPWALLAVAVTSVLTIAATLYDIL*
Ga0079221_100570702	3300006804	Agricultural Soil	MMAKQDETSRLSWPWWAPWALLAVALSSLLTIAATLYDIR*
Ga0079220_101190382	3300006806	Agricultural Soil	MAKQDEVHKLSWPAWAPWALLGVAATSLLTIAATLYDIL*
Ga0075433_117469222	3300006852	Populus Rhizosphere	MAKQDEVHKLSWPAWAPWALLAVAATSLLTIAATLYDIL*
Ga0079219_101016362	3300006954	Agricultural Soil	MTPRDEVQKLPWPWWATWALLAVVVTSLLTIAATLYDIL*
Ga0079219_106603692	3300006954	Agricultural Soil	MTERNETQKLSWPWWAPWALLAVAVTSVLTVAATL
Ga0079219_109858972	3300006954	Agricultural Soil	MAKANETTKLSWPWWAPWALLAVAATSVLTVAATLYDIL*
Ga0079219_110299222	3300006954	Agricultural Soil	MTEQNETQKLSWPWWAPWALLAVAVTSVLTVAATLYDIL*
Ga0105245_101992552	3300009098	Miscanthus Rhizosphere	MAQPHDTNQLSWPWWAPWALLAVAVTSVLTIGATLYDIR*
Ga0105243_100356372	3300009148	Miscanthus Rhizosphere	MAQPHDTNELSWPWWAPWALLAVAVTSVLTLGATLYDIL*
Ga0105248_100051727	3300009177	Switchgrass Rhizosphere	MAKMDETNRLSWPWWAPWALLAVASTSVLTIAATLYDIL*
Ga0105248_129978081	3300009177	Switchgrass Rhizosphere	MAKANGTTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL*
Ga0105237_104436272	3300009545	Corn Rhizosphere	MAKPDEAKSLSWPWWAPWALPGVAATSLLTIAATLYDIL*
Ga0105238_108187221	3300009551	Corn Rhizosphere	MAKANETTKLSWPWWAPWMLLAVAATSLLTLAATLYDIL*
Ga0105249_106450842	3300009553	Switchgrass Rhizosphere	SACTGMATPQETKKLSWPWWAPWALLAIAATSVLTVAATLYDIL*
Ga0126313_100555022	3300009840	Serpentine Soil	MPKFDDTNRLSWPWWSPWALLAVVATSLLTIVATLYDVL*
Ga0126309_100134522	3300010039	Serpentine Soil	MAKITDETHRLSWPWWASWALLAVAATCVVTVAATLYDIL*
Ga0126309_105592722	3300010039	Serpentine Soil	MPKPLAETKLSWAWWAPWALLAVVATALLTLAATLYDIL*
Ga0126314_103386002	3300010042	Serpentine Soil	MPKIDDTNRLSWPWWSPWALLAVVATSLLTIVATLYDIL*
Ga0126318_101085471	3300010152	Soil	REETQRLSWPWWAPWALLAVAVTSLLTVAATLNDIL*
Ga0134066_103487982	3300010364	Grasslands Soil	MAKADDTHKLSWPWWAPWALLAVAATSVLTIAVTLYDIL*
Ga0134066_104259082	3300010364	Grasslands Soil	MAERDDADELSWPWWAPWALLAVAVTSVLTIGATLYDIL*
Ga0134126_128662852	3300010396	Terrestrial Soil	MAKQDKTHKLAWPWWAPWALLGVVATSLLTIAATLNDIL*
Ga0134121_122014552	3300010401	Terrestrial Soil	MARSQDTDELSWPWWAPWALLAVAVTSVLTIGATLYDIL*
Ga0150985_1042889192	3300012212	Avena Fatua Rhizosphere	RDETDKLSWPWWAPWALLAVAATSLLTLAVTLRDIL*
Ga0150985_1050556142	3300012212	Avena Fatua Rhizosphere	RDKTNDLSWPWWASWALLAVAATSLLTIAATLYDIR*
Ga0164300_107402542	3300012951	Soil	MTERNETEKLSWPWWAPWALLAVAATSVLTVAATLYDIL*
Ga0164298_103743232	3300012955	Soil	MSKEAKTNELSWPWWAPWALLAVAVTSLLTIVTTLYDIR*
Ga0164299_105523292	3300012958	Soil	MAKMDETTKLSWPWWGPWALVAVAATCLLTVAATLYDIL*
Ga0164301_102684283	3300012960	Soil	MSKEAKTNELSWPWWAPWALLAVAVTSLLTIVTTLYDSR*
Ga0164301_108614901	3300012960	Soil	MPKMDEANRLSWPWWAPWALLGVAVTCLLTIAAALYDIL*
Ga0134087_108090881	3300012977	Grasslands Soil	VISTIMTKSDETHELSWPWWAPWALLAVALTSLLTVGAALYDIL*
Ga0164304_100106162	3300012986	Soil	MAKMDETDRLSWPWWAPWALLAVAVTSLLTIAATLYDIL*
Ga0164304_104708642	3300012986	Soil	MATPQETKKLSWPWWAPWALLAVAATSVLTIAATLYDIL*
Ga0164306_101909732	3300012988	Soil	MTERNETEKLSWPWWGPWALLAVAATSVLTVAATLYDIL*
Ga0164305_113599292	3300012989	Soil	MAERDDANELSWPWWAPWALLAVAVTSVLTTGATLYDIL*
Ga0157373_101274532	3300013100	Corn Rhizosphere	MTERNETEKLSWPWWAPWALLAVAATSVLTVAATLYDIV*
Ga0157373_103231401	3300013100	Corn Rhizosphere	MAKRDEANRLSWPWWAPWALLAVAATSLLTIAATLHDIL*
Ga0157373_111705292	3300013100	Corn Rhizosphere	MAHQGEKTHRLSWPWWAPWALLAVAATSLLTIAVTLNDIL
Ga0157373_113345741	3300013100	Corn Rhizosphere	MAQQHDTNELSWPWWAPWALLAVAVTSVLTLGATLYDIL*
Ga0157371_102012972	3300013102	Corn Rhizosphere	MPKLDETHRLSWPWWAPWALLAVAATSLLPVAATLNDIL*
Ga0157371_113119692	3300013102	Corn Rhizosphere	DEARRLSWPWWAPWALLAVILTSILTVGATLYDIL*
Ga0157370_105063231	3300013104	Corn Rhizosphere	MAKLDETHRLSRPWWAPWALLAVVLTSILTIGATLYDIL*
Ga0157370_114051371	3300013104	Corn Rhizosphere	MAQRDETRRLSWPWWAPWALLAVAATSLLTIAVTLNDIL*
Ga0157369_100174933	3300013105	Corn Rhizosphere	MAKLDETHRLSWPWWAPWALLAVAITSLMTVAATLNDIL*
Ga0157369_100675592	3300013105	Corn Rhizosphere	MAQRDDAEELSWPGWASWALLAVALTSVLTIGATLYDVL*
Ga0157369_101566153	3300013105	Corn Rhizosphere	ALSRAMPKLDETHRLSWPWWAPWALLAVAATSLLTVAATLNDIL*
Ga0157369_101642302	3300013105	Corn Rhizosphere	MAKMQETQKLSWPWWSAWALLAVAATSVLTIAATLYDIL*
Ga0157369_120996972	3300013105	Corn Rhizosphere	MAKPDEAKSLSWPWWAPWALLGVAATSLLTIAATLYDIL*
Ga0157369_121116901	3300013105	Corn Rhizosphere	MAERDDLDELSWPWWSPWALLAVAVTSLLTIGAALHDIL*
Ga0157374_109855452	3300013296	Miscanthus Rhizosphere	MTPNDEVHKLPWPWWATWVLLAVGLTSLLTIGATLFDIL*
Ga0157378_108595572	3300013297	Miscanthus Rhizosphere	MAKENETTKFAWPWWAPWMLLAVAATSLLTVAATLYDIL*
Ga0157378_116701072	3300013297	Miscanthus Rhizosphere	MATPQETKKLSWPWWASWALLAVAATSVLTIAATLYDIL*
Ga0157375_108683742	3300013308	Miscanthus Rhizosphere	MSRTDPKRLSWPWWAAWALFGVALTSLLTIAATLNDIL*
Ga0157375_117118782	3300013308	Miscanthus Rhizosphere	MATPQETKKLSWPWWAPWALLAVAATSFLTIAATLYDIL*
Ga0157375_129494501	3300013308	Miscanthus Rhizosphere	HDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIR*
Ga0134079_100576152	3300014166	Grasslands Soil	MTKMDESTKLSWPWWSSWALLAVAATSVLTVAATLYDIL*
Ga0157380_114995252	3300014326	Switchgrass Rhizosphere	MAQPHDTNQLSWPWWAPWALLAVAVTSVLTIGATL
Ga0182008_101609112	3300014497	Rhizosphere	MARSDETNDLSWPWWAPWALLAVAATSLLTVGVTLYDIL*
Ga0167658_10089973	3300015195	Glacier Forefield Soil	MARPNDTAGLSWPWWALVAVALTSLLTIGATVYDIL*
Ga0132258_102570723	3300015371	Arabidopsis Rhizosphere	MEDSKLQKLSWPWWAPWTLVAVIVGSALTIAATLYDIL*
Ga0132258_114804782	3300015371	Arabidopsis Rhizosphere	MAEGDDAKELSWPGWASWALLAVALTSVLTIGATLYDIL*
Ga0132257_1019888362	3300015373	Arabidopsis Rhizosphere	MEDSKLQKLSWPWWAPWALVAVIVGSALTIAATLYDIL*
Ga0132255_1023585332	3300015374	Arabidopsis Rhizosphere	MEDSDLQRLSWPWWAPWALVAVIVGSALTIAATLYDIL*
Ga0163161_114050261	3300017792	Switchgrass Rhizosphere	MAEFDERKRLSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0066667_114079441	3300018433	Grasslands Soil	SDEAHELSWPWWAPWALLAVALTSLLTVAATLYDIL
Ga0066662_100455991	3300018468	Grasslands Soil	MAKLDETERLSWPWWAPWALLAVAATSLLTIGATLYDIL
Ga0066662_103105151	3300018468	Grasslands Soil	MAKFDDTHKLSWPWWAPWALLAVAATCLLTVAAALYDIL
Ga0066662_103258732	3300018468	Grasslands Soil	MAKPDETNELSWPWWAPWALLAVAATSLLTIGATLYDIL
Ga0066662_103920392	3300018468	Grasslands Soil	MESRDETRRLSWPWWANWALLAVIVTSLVTIAATLYDIL
Ga0066662_109600312	3300018468	Grasslands Soil	MAKPDEAQVLSWPWWAPWALLAVALTSLLTIGATLYDIL
Ga0066662_109697772	3300018468	Grasslands Soil	MTKLDETHELSWPWWAPWALLAVALTSLLTVGAALYDIL
Ga0066662_123551391	3300018468	Grasslands Soil	MEKRDETNRLSWPWWAPWALLAVVVTSAATIAATLYDIL
Ga0066669_116917492	3300018482	Grasslands Soil	MTKMDESTKLSWPWWSSWALLAVAATSVLTVAATLYDIL
Ga0197907_103816891	3300020069	Corn, Switchgrass And Miscanthus Rhizosphere	MAKQDATHKLAWPWWSPWALIAVVVTSLLTIAATLNDIL
Ga0206356_107828591	3300020070	Corn, Switchgrass And Miscanthus Rhizosphere	QDETNKLSWPWWAPWALLAVALSSLLTIAATLYDIR
Ga0206352_110475942	3300020078	Corn, Switchgrass And Miscanthus Rhizosphere	LAHSRIVEAMAKQDATHKLAWPWWSPWALIAVVVTSLLTIAATLNDIL
Ga0206354_101393562	3300020081	Corn, Switchgrass And Miscanthus Rhizosphere	MPKLDETHRLSWPWWAPWALLAVAATSLLTVAATLNDIL
Ga0206354_103907231	3300020081	Corn, Switchgrass And Miscanthus Rhizosphere	EPDATHELSWPWWAPWAVLAVALTSLLTIAATLYDIL
Ga0206353_107534942	3300020082	Corn, Switchgrass And Miscanthus Rhizosphere	MSQREKTNELSWPWWAPWALLAVAITSLLTIAATLYDIR
Ga0206353_112811962	3300020082	Corn, Switchgrass And Miscanthus Rhizosphere	MANPEEIHELSWPWWSSWALLAVAVTSVLTIAATLYDIL
Ga0196963_105026932	3300020215	Soil	VSDQDETQKLSWPWWSPWVLLAVVATSMLTIGATLYDIL
Ga0193706_10100213	3300021339	Soil	MHMTKSDETHRLSWPWWASWALLAVAVTCVVTVAATFYDIL
Ga0213882_102947511	3300021362	Exposed Rock	MAKLDETHALSWPWWAPWALLAVALTSLLTIAATLYDIL
Ga0182009_100128402	3300021445	Soil	MAQKDEVKKLSWPWWAPWALLAVALTSLLTIAATLYDIL
Ga0182009_101450792	3300021445	Soil	MDETRKLSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0182009_101793013	3300021445	Soil	MAKANETTKLSWPWWAPWALLAVAATSLLTVAATLYDIL
Ga0182009_104724811	3300021445	Soil	AKMDETHRLSWPWWAPWTLLAVAATSVLTIAATLYDIL
Ga0207666_10573671	3300025271	Corn, Switchgrass And Miscanthus Rhizosphere	MQERDDTNRLSWPLWAPWALLAVAITSVLTIGATLYDIL
Ga0207697_100053693	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MAQQHDTNELSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0207697_100082693	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MQERDDTNRLSWPWWAPWALLAVAITSVLTIGATLYDIL
Ga0207697_100588682	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MAHSDEAPKIPWPWWSTWALVAVVATSILTIAATLYDIL
Ga0207697_104705521	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MAERDDAEELSWPGWASWALLAVALTSVLTIGAILYDIL
Ga0207656_100325972	3300025321	Corn Rhizosphere	MAEQDETNKLSWPWWAPWALLAVALSSLLTIAATLYDIR
Ga0207656_100670032	3300025321	Corn Rhizosphere	MAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL
Ga0207656_100927062	3300025321	Corn Rhizosphere	MTPNDEVHKLPWPWWATWVLLAVVLTSLLTIGATLFDIL
Ga0207656_102879481	3300025321	Corn Rhizosphere	MAKSDEARRLSWPWWAPWALLAVILTSILTVGATLYDIL
Ga0207682_100662821	3300025893	Miscanthus Rhizosphere	MAQPHDTNELSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0207642_100253052	3300025899	Miscanthus Rhizosphere	MAQPHDTNQLSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0207642_100310641	3300025899	Miscanthus Rhizosphere	MAERDDAEELSWPGWASWALFAVALTSVLTIGATLYDIL
Ga0207688_101544582	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MAQPHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0207688_110824602	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	DGTAAVRQASDMASKQETKKLSWPRWAPWALLAVAATSVLTVAATLYDIL
Ga0207680_100026821	3300025903	Switchgrass Rhizosphere	ASNGMASSQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0207680_100130812	3300025903	Switchgrass Rhizosphere	MAERDDAEELSWPGWASWALLAVALTSVLTIGATLYDIL
Ga0207680_100412242	3300025903	Switchgrass Rhizosphere	MANPQETKKLSWPWWAPWALLAVAATSVLTIAATLYDIL
Ga0207680_103196262	3300025903	Switchgrass Rhizosphere	MAQQHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0207647_100104613	3300025904	Corn Rhizosphere	MARLQDSDELSWPRWALLAVAATSVLTIGATLYDIL
Ga0207647_100221882	3300025904	Corn Rhizosphere	MAQQHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIR
Ga0207647_102091452	3300025904	Corn Rhizosphere	MAQREERTHRLSWPWWASWALLAVAATSLLTIAVTLNDIL
Ga0207647_102469332	3300025904	Corn Rhizosphere	MPERDDIRELSWPWWAPWALFAVAVTSVLTVAVTLRDIL
Ga0207647_103113072	3300025904	Corn Rhizosphere	MAKRDETDRLSWPWWAPWALLGVAATSLLTIAATLHDIL
Ga0207647_104280362	3300025904	Corn Rhizosphere	MAERDDLDGLSWPWWSPWALLAVAVTSLLTIGAALHDIL
Ga0207645_106186351	3300025907	Miscanthus Rhizosphere	LKPRGAMAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL
Ga0207705_100017946	3300025909	Corn Rhizosphere	MSQREKTNELSWPWWALWALLAVAITSLLTIAATLYDIR
Ga0207705_100144612	3300025909	Corn Rhizosphere	MAKMDETDRLSWPGWAPWALLAVAVTSLLTIAATLYDIL
Ga0207705_100330294	3300025909	Corn Rhizosphere	MAKQDETTRLSWPWWAPWALLAVAVTSLLTIAATLYDIR
Ga0207705_100503232	3300025909	Corn Rhizosphere	MAKLDETHRLSWPRWAPWALLAVVLTSILTIGATLYDIL
Ga0207705_100725892	3300025909	Corn Rhizosphere	MAKLDETERLSWPWWAPWALLAVVLTSILTIGATLYDIL
Ga0207705_101008062	3300025909	Corn Rhizosphere	MMAKQDETNRLSWPWWAPWALLAVALSSLLTIAATLYDIR
Ga0207705_101285472	3300025909	Corn Rhizosphere	MANPEETRELSWPWWSSWALLAVAVTSVLTIAATLYDIL
Ga0207705_102445801	3300025909	Corn Rhizosphere	STGRKPRGAMAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL
Ga0207705_105589572	3300025909	Corn Rhizosphere	MAKMDETHRLSWPWWASWALLAVAVTCALTVAATLYDIL
Ga0207705_107967462	3300025909	Corn Rhizosphere	MAKRDETTRLAWPWWAPWALLGVAVTSLLTIAATLNDIL
Ga0207705_111403942	3300025909	Corn Rhizosphere	ALVSERFPMADQDKANQLSWPWWAPWALLAVALTSVLTIGATLYDIL
Ga0207705_111890692	3300025909	Corn Rhizosphere	MAKPNEAKSLSWPWWAPWALLAVALTSLLTIAATLYDIL
Ga0207705_113502221	3300025909	Corn Rhizosphere	RALSRAMPKLDETHRLSWPWWAPWALLAVAATSLLTVAATLNDIL
Ga0207707_100318813	3300025912	Corn Rhizosphere	MAQREERTHRLSWPWWASWALLAIAATSLLTIAVTLNDIL
Ga0207707_103559812	3300025912	Corn Rhizosphere	FTAVAKMDETRRLSWPWWSSWALLAVAATSVLTIAATLYDIL
Ga0207695_103455342	3300025913	Corn Rhizosphere	MAEQDETNKLSWPWWASWALLAVALSSLLTIAATLYDIR
Ga0207663_117232192	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	KDFRGMAKMDETHRLSWPWWAPWALLAVALTSVLTIAATLYDIL
Ga0207660_1000015923	3300025917	Corn Rhizosphere	MAKQDETHKLAWPWWAPWALLAVVATSLLTIAATLNDIL
Ga0207660_100003297	3300025917	Corn Rhizosphere	MAKHDATHKLAWPWWSPWALLAVVVTSLLTIAATLNDIL
Ga0207660_110755721	3300025917	Corn Rhizosphere	KDFIAMANPEEIHELSWPWWSSWALLAVAVTSVLTIAATLYDIL
Ga0207662_107523071	3300025918	Switchgrass Rhizosphere	MASSQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0207657_100035956	3300025919	Corn Rhizosphere	MAERDDLDGLSWPWWSPWALLAVAATSLLTIGAALHDIL
Ga0207657_100103946	3300025919	Corn Rhizosphere	MADQDKANQLSWPWWAPWALLAVALTSVLTIGATLYDIL
Ga0207657_100124472	3300025919	Corn Rhizosphere	MPERDDIRELSWPWWAPWALLAVAVTSVLTVAVTLRDIL
Ga0207657_101573792	3300025919	Corn Rhizosphere	MANQEEIHELSWPWWSSWALLAVAVTSVLTIAATLYDIL
Ga0207657_103160521	3300025919	Corn Rhizosphere	MAKRDETTRLSWPWWAPWALLAVALASLLTIAATLYDIR
Ga0207657_106657262	3300025919	Corn Rhizosphere	MAKQDATHKLAWPWWAPWALLAVVVTSLLTIAATLNDIL
Ga0207649_100435903	3300025920	Corn Rhizosphere	MAKTTDETSKVSWPWWASWALLAVAATSVLTVAATLYDIL
Ga0207649_100555543	3300025920	Corn Rhizosphere	MTDRNETHKLSWPWWAPWALLAVAATSVLTVAATLYDIL
Ga0207649_114867852	3300025920	Corn Rhizosphere	MDKRDETHRLSWPWWAPWALLAVAATSLLTIAVTLNDIL
Ga0207652_102589902	3300025921	Corn Rhizosphere	MDETRRLSWPWWSSWALLAVAATSVLTIAATLYDIP
Ga0207652_112871972	3300025921	Corn Rhizosphere	EQSKATKLSWPWWSPWALLAVVATSVLTIAATLYDIL
Ga0207652_118289601	3300025921	Corn Rhizosphere	MARRDAPHRLSWPWWAPWTLLAVAATSLLTIAVTLNDIL
Ga0207694_104193382	3300025924	Corn Rhizosphere	MAKRDETQRLSWPWWAPWALLAVAATSLLTIAVTLNDIL
Ga0207694_112628841	3300025924	Corn Rhizosphere	MSQREKTNELSWPWWAPWALLAVAVTSLLTIAATLYDIR
Ga0207694_112693811	3300025924	Corn Rhizosphere	SGGGAFPSPKGWSAGLKPRGAMAKANETTKLSWPWWAPWMLLAVAATSLLTLAATLYDIL
Ga0207650_100817263	3300025925	Switchgrass Rhizosphere	MEDSDLQKLSWPWWAPWALVAVIVGSALTIAATLYDIL
Ga0207700_111813212	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MAERDKTHELSWPWWAPWALLGVALTSLLTVGATLYDII
Ga0207664_106427161	3300025929	Agricultural Soil	MAKHDEAKSLSWPWWAPWALLAVALTSLLTIAATLYDIL
Ga0207664_112132122	3300025929	Agricultural Soil	IVGTMAKQDETHKLAWPWWAPWALLAVVATSLLTIAATLNDIL
Ga0207644_116056882	3300025931	Switchgrass Rhizosphere	RRYGRAFTGMANPQETKKLSWPWWAPWALLAVAATSVLTIAATLYDIL
Ga0207690_100380192	3300025932	Corn Rhizosphere	MANSDEANRLSWPWWAPWALLAVIATSALTIAATLYDIL
Ga0207690_101575682	3300025932	Corn Rhizosphere	MAQPHDTSQLSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0207690_106941961	3300025932	Corn Rhizosphere	MAKRDETTRLSWPWWAPWALLAVALTSLLTIAATLYDIR
Ga0207690_108131502	3300025932	Corn Rhizosphere	MAEQDKANRLSWPWWAPWALLAVALTSVLTIGATLYDIL
Ga0207690_110736891	3300025932	Corn Rhizosphere	CSTRGLKMAERDDAEELSWPGWASWALLAVALTSVLTIGATLYDVL
Ga0207690_111479052	3300025932	Corn Rhizosphere	MTDETRKLSWPWWASWVLLAVAATSVLTVAATLYDIL
Ga0207690_112039921	3300025932	Corn Rhizosphere	MAKLDETHRLSWPWWAPWALLAVAVTCVATVAATLYDIL
Ga0207706_100145992	3300025933	Corn Rhizosphere	MSKPIETDALSWTSWAPWTLLVVDATPVRMVGATLYDIL
Ga0207706_104697432	3300025933	Corn Rhizosphere	VAKLDETNQLSWPWWAPWVLLAVAATSVLTIAATLYDIL
Ga0207706_113862342	3300025933	Corn Rhizosphere	MSSQDETKKLSWPGWAPWALLAVAATSLLTVAATLYDIL
Ga0207706_115917572	3300025933	Corn Rhizosphere	AEQDETNKLSWPWWAPWALLAVALSSLLIIAATLYDIR
Ga0207709_117308582	3300025935	Miscanthus Rhizosphere	RYMAQPHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0207670_100920062	3300025936	Switchgrass Rhizosphere	MAKQDEVHKLSWPGWAPWALLAVAATSLLTIAATLYDIL
Ga0207669_100053104	3300025937	Miscanthus Rhizosphere	MARSQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0207669_100462653	3300025937	Miscanthus Rhizosphere	MASKQDKKLSGPRWAPRALLAVAATSVLTVAATLYD
Ga0207669_100475272	3300025937	Miscanthus Rhizosphere	MAKSDEIDALSWPWWVPRSVLAVAATSVLTVAAALYDIL
Ga0207669_101299701	3300025937	Miscanthus Rhizosphere	RYMAQPHDTNQLSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0207669_113722622	3300025937	Miscanthus Rhizosphere	MAERDDANELSWPWWASWALLAVALTSVLTIGATLYDIL
Ga0207704_101209162	3300025938	Miscanthus Rhizosphere	MAQPHDTNELSWPWWAPWALLAVAVTSVLTLGATLYDIL
Ga0207689_107609492	3300025942	Miscanthus Rhizosphere	MAERDDANELSWPWWAPWALIAVAATSLLTIGATLYDIL
Ga0207679_100350513	3300025945	Corn Rhizosphere	MAKIGETHRLSWPWWAPWALLAVAITSVLTIAATLYDIL
Ga0207679_103229942	3300025945	Corn Rhizosphere	MSQREKTNELSWPWWALLAVAITSLLTIAATLYDIR
Ga0207667_100952312	3300025949	Corn Rhizosphere	MPKLDETHRLSWPWWAPWALLAVAATSLLTVAATLSDIL
Ga0207712_105295701	3300025961	Switchgrass Rhizosphere	MAKSANQRLSWPWWAPWALLAVVATSLLTVAATLYDII
Ga0207640_101599792	3300025981	Corn Rhizosphere	MTPNDEVHKLPWPWWATWVLLAVVLTSLLTIGATLFDFL
Ga0207658_109459262	3300025986	Switchgrass Rhizosphere	MATPQETKKLSWPWWASWALLAVAATSVLTIAATLYDIL
Ga0207639_103617312	3300026041	Corn Rhizosphere	MSLRDETSRLSWPWWAPLAPIAVAATSLLTIAVTLDDIL
Ga0207639_108227252	3300026041	Corn Rhizosphere	MAEFDVRKRLSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0207678_102295592	3300026067	Corn Rhizosphere	MAKLDETHRLSWPWWAPWALLAVAATCLLTVAATLNDIL
Ga0207676_102633452	3300026095	Switchgrass Rhizosphere	MTDETRKLSWPWWAPWALMAVAATSVLTVAATLYDIL
Ga0207674_100269702	3300026116	Corn Rhizosphere	MAKQDATHRLSWPSWAWSALLAVVATSLLTIAVTLNDIL
Ga0207698_103221972	3300026142	Corn Rhizosphere	MAKQDATHKLAWPWWAPWTLLAVVVTSLLTIAATLNDIL
Ga0207698_104642831	3300026142	Corn Rhizosphere	MAKQDEVRKLSWPGWAPWALLGVAATSLLTIAATLYDIL
Ga0207698_107197312	3300026142	Corn Rhizosphere	MARSDEDPKLPWPWWSTWALAAVVATSILTIAATLYDIF
Ga0207698_122781662	3300026142	Corn Rhizosphere	MASKQETKKLSWPRWAPWALLAVAATSVLTVAATLYDIL
Ga0207698_127167672	3300026142	Corn Rhizosphere	MAKQDATHKLAWPWWAPWALLAVVATSLLTIAATLNDIL
Ga0209647_10466002	3300026319	Grasslands Soil	MAKPDEANELSWPWWAPWALLAVAATSLLTIGATLYDIL
Ga0209470_11049201	3300026324	Soil	MSRSQQTSKLSWPWWSPWALIAVVVTTLLTIAVTLYDIL
Ga0209470_12587481	3300026324	Soil	MAKFDEANELSWPWWAPWALLAVAATSLLTIGATLY
Ga0209267_10262143	3300026331	Soil	MPKHDEAQKLSWPWWAPWALVAVAVTSVLTIAATLDDIL
Ga0209806_11456681	3300026529	Soil	MAERDDANELSWPWWAPWGLLAVAVTSLLTIGATLYDIL
Ga0209178_14142511	3300027725	Agricultural Soil	MMAKQDETSRLSWPWWAPWALLAVALSSLLTIAATLYDIR
Ga0209461_101584192	3300027750	Agave	MAERDETHKLSWPWWAPWALLAVALTSVLTVAVTLRDIL
Ga0209796_100056012	3300027766	Agave	MAKRDETNALSWPWWAPWALLAVAATSLLTVWVTLNDIL
Ga0209796_100143813	3300027766	Agave	MAKRDELQKLSWPWWSPWALIAVVLTSALTIAATLNDIL
Ga0209796_100146612	3300027766	Agave	LDLATAFAHSSEMAKRDETKELSWPVWAPWVLLAVAATSLLTVWVTLNDIL
Ga0209796_100356072	3300027766	Agave	MAKWDETNKLAWPWWAPWALLIVAATSLLTVAATLNDIL
Ga0209796_100455541	3300027766	Agave	MSQREETQRLSWPWWSMWALLAVAVTSVLTIAVTLNDIL
Ga0209796_100673021	3300027766	Agave	MAKMDETHRLSWPWWAPWALLGVAITSALTIAVTLYDIL
Ga0209796_100820511	3300027766	Agave	MAKTDETHRLSWPWWAPWALLAVAATSLLTIAATLNDIL
Ga0209810_10204652	3300027773	Surface Soil	MAKMDETHRLSWPWWAPWALLGVAVTSALTIAATLYDIL
Ga0247719_10026822	3300028041	Soil	MAEQDKAHKLSWPWWAPWALIVVAATSGLTVAVAIYDIL
Ga0268266_100212872	3300028379	Switchgrass Rhizosphere	MTPNDEVHKLPWPWWATWVLLAIVLTSLLTIGATLYDIL
Ga0268266_108936523	3300028379	Switchgrass Rhizosphere	MAKSANQRLSWPWWAPWALLAVVATSLLTVAATLYDIL
Ga0268266_110388872	3300028379	Switchgrass Rhizosphere	FSRMAKMTDETRKLSWPWWAPWTLLAVVATSVLTVAATLYDIL
Ga0268240_101105101	3300030496	Soil	MTKSDETTELSWPWWAPWALLAVALTSLLTVGATLYDIL
Ga0268241_100300602	3300030511	Soil	VADKEEVHKLSWPWWAPWALLAVAATCVLTIAATLYDIL
Ga0307408_1008856052	3300031548	Rhizosphere	MSKQDETQELSWPWWAPWALLAVAITSLLTVAAALYDIL
Ga0310813_109986851	3300031716	Soil	MAQRDETRRLSWPWWAPWALLGIAATSLLTIAVTLNDIL
Ga0307405_100791802	3300031731	Rhizosphere	VAKLDETNRLSWPWWAPWALLAVAATSVLTIAATLYDIL
Ga0307405_100830712	3300031731	Rhizosphere	MATWDETNKLSWPWWAPWALLAVALTPLMTVGATLYDIL
Ga0308175_1000110522	3300031938	Soil	MAEQDRTRRLSWPWWSPWALVAVVVTCLLTIAATLYDIL
Ga0308175_1000550772	3300031938	Soil	MTKSGDAQKLSWPWWAPWALLAVAATSLLTIAATLYDIL
Ga0308175_1000809092	3300031938	Soil	MTKSDETTELSWPWWAAWALLAVALTSLLTVGATLYDIL
Ga0308175_1001275263	3300031938	Soil	MAKQDETHKLSWPGWAWWALAAVIVTSLLTIAATLRDIL
Ga0308175_1001468163	3300031938	Soil	RFAKPFAGMLKSADPQRLSWPWWAPWALLGVAVTSVLTIAATLYDIL
Ga0308175_1002369902	3300031938	Soil	MAKFDEPDRLSWPWWAPWALLAVAVTSILTIGATLYDIL
Ga0308175_1003385862	3300031938	Soil	MAKMDEAHRLSWPWWAPWALLGVAVTSVLTIAATLYDIL
Ga0308175_1003821731	3300031938	Soil	MAKPDETNALAWPRWAPWALLAVAATSLLTIAATLYDIL
Ga0308175_1004051362	3300031938	Soil	TLMSQREKTNELSWPWWAPWALLAVAITSLLTIAATLYDIR
Ga0308175_1006530912	3300031938	Soil	MTERNETHELAWPWWAPWALLAVAATSVLTVAATLYDIL
Ga0308175_1008221972	3300031938	Soil	MAKPDETTELSWPWWAPWALLAVAATSALTIGATLYDIL
Ga0308175_1011340861	3300031938	Soil	MAKADETQKLSWPWWSAWALLAVAATSVLTIAATLYDIL
Ga0308175_1011834812	3300031938	Soil	MAKREETTKLSWPWWSPWALLAVVVTALLTIAATLYDIR
Ga0308175_1012110112	3300031938	Soil	MTKSEETDELSWPWWAPWALIAVALTSLLTIGATLYDIL
Ga0308175_1014972002	3300031938	Soil	MAKPDETNELSWPWWAPWALLAVAATSALTIGATLYDIL
Ga0308175_1023643431	3300031938	Soil	MAKLDETHRLSWPWWAPWALLAVVLTSILTIGATLYDIL
Ga0308175_1025068012	3300031938	Soil	MSKSQEASKLSWPWWAPWALLAVIVTSILTIGVTFYDIL
Ga0308175_1028132842	3300031938	Soil	RMAKITDETHQLSWPWWAPWALVAVAATSLLTVAATLYDIL
Ga0308174_101955622	3300031939	Soil	MAKMDETHRLSWPWWAPWALLGVAVTSALTIAVTLYDIL
Ga0308174_102544702	3300031939	Soil	KDNVRRLSWPWWSAWALLAVVLTSVVTIAATLYDIR
Ga0308174_104352362	3300031939	Soil	MAKPDETHALSWPWWAPWALLAVALTSLLTVGATLYDIL
Ga0308174_110659542	3300031939	Soil	MAKMDETHRLSWPWWAPWTLLAVAATSVLTIAATLYDIL
Ga0308174_115843922	3300031939	Soil	MAKMDETHRLSWPWWAPWALLAVAVTSVLTISATLYDIL
Ga0308174_117806881	3300031939	Soil	MAKKDDAHRLSWPWWSPWALVAVVLTSILTIAATLYDIR
Ga0307409_1004125312	3300031995	Rhizosphere	MANGDDMPKLSWPWWAPWALLAVAVTSVLTIVVTVYTAG
Ga0308176_106643262	3300031996	Soil	MAKMDETHRLSWPRWAPWALLAVVATSLLTIAATLYDIL
Ga0308176_116330222	3300031996	Soil	VTKDDDAHRMSWPWWAPWVLLAVVLSCAATVAATLYDIW
Ga0308176_128230371	3300031996	Soil	DEAHRLSWPRWAPWALLAVAATSLLTIAATLYDIL
Ga0307416_1021891101	3300032002	Rhizosphere	MAKKEEVDRLSWPWWAPWALLAVAATSLLTVAATLYDIL
Ga0307416_1033649821	3300032002	Rhizosphere	MAKNEEVDRLSWPWWAPWALLAVAATSLLTVAATLYDIL
Ga0310897_100676522	3300032003	Soil	MEDSNIQKLSWPWWAPWALVAVIVGSALTIAATLYDIL
Ga0308173_101105042	3300032074	Soil	MSNSVDPRRLSWPWWASWALLGVVATSLMTIAATLYDIL
Ga0308173_104678492	3300032074	Soil	MTKSADPQRLSWPWWAPWALLGVAVTSLLTIAATLYDIL
Ga0326721_107115492	3300032080	Soil	MPKINDTNRISWPWWAPWALFAVAATSLLTIVATLYDIL
Ga0334929_046803_518_637	3300034135	Hypolithic Biocrust	MAKWSKTDKLSWPWWAPWALLAVAATCVLTVGATLYDIL
Ga0372943_0044846_1741_1860	3300034268	Soil	MAEHDETERLSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0372943_0787501_43_162	3300034268	Soil	MANPDEANELSWPWWAPWALLAVAATSLLTIGATLYDIL