Basic Information | |
---|---|
Family ID | F004548 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 433 |
Average Sequence Length | 46 residues |
Representative Sequence | DFACFLNRFAAGDPYANCDASTTPPVLNVNDFSCFLNRFAAGCS |
Number of Associated Samples | 180 |
Number of Associated Scaffolds | 433 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.17 % |
% of genes near scaffold ends (potentially truncated) | 96.77 % |
% of genes from short scaffolds (< 2000 bps) | 96.77 % |
Associated GOLD sequencing projects | 157 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.72 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (62.356 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.471 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.028 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.732 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.72 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 433 Family Scaffolds |
---|---|---|
PF00072 | Response_reg | 0.92 |
PF07638 | Sigma70_ECF | 0.92 |
PF07995 | GSDH | 0.69 |
PF00437 | T2SSE | 0.69 |
PF00326 | Peptidase_S9 | 0.69 |
PF01212 | Beta_elim_lyase | 0.69 |
PF00694 | Aconitase_C | 0.69 |
PF05157 | T2SSE_N | 0.69 |
PF13418 | Kelch_4 | 0.46 |
PF00375 | SDF | 0.46 |
PF00005 | ABC_tran | 0.46 |
PF13633 | Obsolete Pfam Family | 0.46 |
PF00171 | Aldedh | 0.46 |
PF01370 | Epimerase | 0.46 |
PF07452 | CHRD | 0.46 |
PF00400 | WD40 | 0.46 |
PF13377 | Peripla_BP_3 | 0.46 |
PF14684 | Tricorn_C1 | 0.46 |
PF02965 | Met_synt_B12 | 0.46 |
PF00498 | FHA | 0.46 |
PF01391 | Collagen | 0.46 |
PF00891 | Methyltransf_2 | 0.46 |
PF13414 | TPR_11 | 0.46 |
PF00069 | Pkinase | 0.46 |
PF01642 | MM_CoA_mutase | 0.23 |
PF05193 | Peptidase_M16_C | 0.23 |
PF01979 | Amidohydro_1 | 0.23 |
PF05572 | Peptidase_M43 | 0.23 |
PF12680 | SnoaL_2 | 0.23 |
PF12770 | CHAT | 0.23 |
PF08327 | AHSA1 | 0.23 |
PF04389 | Peptidase_M28 | 0.23 |
PF00801 | PKD | 0.23 |
PF03331 | LpxC | 0.23 |
PF00374 | NiFeSe_Hases | 0.23 |
PF02133 | Transp_cyt_pur | 0.23 |
PF13520 | AA_permease_2 | 0.23 |
PF00246 | Peptidase_M14 | 0.23 |
PF02518 | HATPase_c | 0.23 |
PF06144 | DNA_pol3_delta | 0.23 |
PF13374 | TPR_10 | 0.23 |
PF00006 | ATP-synt_ab | 0.23 |
PF13193 | AMP-binding_C | 0.23 |
PF13328 | HD_4 | 0.23 |
PF07679 | I-set | 0.23 |
PF04237 | YjbR | 0.23 |
PF01624 | MutS_I | 0.23 |
PF07617 | DUF1579 | 0.23 |
PF01557 | FAA_hydrolase | 0.23 |
PF13847 | Methyltransf_31 | 0.23 |
PF03703 | bPH_2 | 0.23 |
PF08281 | Sigma70_r4_2 | 0.23 |
PF00829 | Ribosomal_L21p | 0.23 |
PF00571 | CBS | 0.23 |
PF13493 | DUF4118 | 0.23 |
PF01641 | SelR | 0.23 |
PF06267 | DUF1028 | 0.23 |
PF13579 | Glyco_trans_4_4 | 0.23 |
PF01040 | UbiA | 0.23 |
PF16884 | ADH_N_2 | 0.23 |
PF09844 | DUF2071 | 0.23 |
PF11845 | DUF3365 | 0.23 |
PF14235 | DUF4337 | 0.23 |
PF13517 | FG-GAP_3 | 0.23 |
PF00408 | PGM_PMM_IV | 0.23 |
PF05192 | MutS_III | 0.23 |
PF00574 | CLP_protease | 0.23 |
PF13738 | Pyr_redox_3 | 0.23 |
PF02897 | Peptidase_S9_N | 0.23 |
PF00384 | Molybdopterin | 0.23 |
PF02353 | CMAS | 0.23 |
PF03006 | HlyIII | 0.23 |
PF01168 | Ala_racemase_N | 0.23 |
PF00583 | Acetyltransf_1 | 0.23 |
PF07691 | PA14 | 0.23 |
PF07228 | SpoIIE | 0.23 |
PF02768 | DNA_pol3_beta_3 | 0.23 |
PF01546 | Peptidase_M20 | 0.23 |
PF16363 | GDP_Man_Dehyd | 0.23 |
PF12728 | HTH_17 | 0.23 |
PF00749 | tRNA-synt_1c | 0.23 |
PF00528 | BPD_transp_1 | 0.23 |
PF02244 | Propep_M14 | 0.23 |
PF03147 | FDX-ACB | 0.23 |
PF13424 | TPR_12 | 0.23 |
PF13450 | NAD_binding_8 | 0.23 |
PF04519 | Bactofilin | 0.23 |
PF13844 | Glyco_transf_41 | 0.23 |
PF06739 | SBBP | 0.23 |
PF12850 | Metallophos_2 | 0.23 |
PF00884 | Sulfatase | 0.23 |
PF00346 | Complex1_49kDa | 0.23 |
PF13205 | Big_5 | 0.23 |
PF01928 | CYTH | 0.23 |
PF00793 | DAHP_synth_1 | 0.23 |
PF02441 | Flavoprotein | 0.23 |
PF13580 | SIS_2 | 0.23 |
PF09394 | Inhibitor_I42 | 0.23 |
PF01966 | HD | 0.23 |
PF02631 | RecX | 0.23 |
PF01609 | DDE_Tnp_1 | 0.23 |
PF01323 | DSBA | 0.23 |
PF00248 | Aldo_ket_red | 0.23 |
PF13229 | Beta_helix | 0.23 |
PF07676 | PD40 | 0.23 |
PF12801 | Fer4_5 | 0.23 |
PF00082 | Peptidase_S8 | 0.23 |
PF00575 | S1 | 0.23 |
PF13524 | Glyco_trans_1_2 | 0.23 |
PF03466 | LysR_substrate | 0.23 |
PF01583 | APS_kinase | 0.23 |
PF04093 | MreD | 0.23 |
COG ID | Name | Functional Category | % Frequency in 433 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.85 |
COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.39 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.92 |
COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.69 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.69 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.69 |
COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.69 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.69 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.69 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.69 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.69 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.69 |
COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.69 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.69 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.69 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.69 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.69 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.69 |
COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 0.46 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.46 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.46 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.46 |
COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 0.46 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.46 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.46 |
COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 0.23 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.23 |
COG3259 | Coenzyme F420-reducing hydrogenase, alpha subunit | Energy production and conversion [C] | 0.23 |
COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.23 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.23 |
COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.23 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.23 |
COG2891 | Cell shape-determining protein MreD | Cell wall/membrane/envelope biogenesis [M] | 0.23 |
COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 0.23 |
COG2812 | DNA polymerase III, gamma/tau subunits | Replication, recombination and repair [L] | 0.23 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.23 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.23 |
COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.23 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.23 |
COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.23 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.23 |
COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.23 |
COG0072 | Phenylalanyl-tRNA synthetase beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.23 |
COG0261 | Ribosomal protein L21 | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0374 | Ni,Fe-hydrogenase I large subunit | Energy production and conversion [C] | 0.23 |
COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.23 |
COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.23 |
COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 0.23 |
COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 0.23 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.23 |
COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.23 |
COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.23 |
COG1466 | DNA polymerase III, delta subunit | Replication, recombination and repair [L] | 0.23 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.23 |
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.23 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.23 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.23 |
COG2137 | SOS response regulatory protein OraA/RecX, interacts with RecA | Posttranslational modification, protein turnover, chaperones [O] | 0.23 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.23 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 62.36 % |
All Organisms | root | All Organisms | 37.64 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2070309009|GPKNP_GG3DY5401BRGGU | Not Available | 517 | Open in IMG/M |
2088090009|LWAnN_F624WLL02HJRIA | Not Available | 528 | Open in IMG/M |
2170459005|F1BAP7Q02F6VIM | Not Available | 524 | Open in IMG/M |
2170459010|GIO7OMY02IUBI1 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
2170459015|G14TP7Y02HES09 | Not Available | 726 | Open in IMG/M |
3300004114|Ga0062593_102204616 | Not Available | 617 | Open in IMG/M |
3300004153|Ga0063455_100425702 | Not Available | 794 | Open in IMG/M |
3300004153|Ga0063455_101480759 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 528 | Open in IMG/M |
3300004156|Ga0062589_101283923 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales | 706 | Open in IMG/M |
3300004156|Ga0062589_102112582 | Not Available | 574 | Open in IMG/M |
3300004157|Ga0062590_101198150 | Not Available | 740 | Open in IMG/M |
3300005184|Ga0066671_11025665 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 518 | Open in IMG/M |
3300005330|Ga0070690_101025338 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 651 | Open in IMG/M |
3300005330|Ga0070690_101593521 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005330|Ga0070690_101714170 | Not Available | 511 | Open in IMG/M |
3300005331|Ga0070670_102270341 | Not Available | 500 | Open in IMG/M |
3300005332|Ga0066388_101282251 | Not Available | 1261 | Open in IMG/M |
3300005332|Ga0066388_101312205 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
3300005332|Ga0066388_101584995 | Not Available | 1151 | Open in IMG/M |
3300005332|Ga0066388_102097048 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → Phycisphaeraceae → unclassified Phycisphaeraceae → Phycisphaeraceae bacterium | 1017 | Open in IMG/M |
3300005332|Ga0066388_102887774 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300005332|Ga0066388_103995575 | Not Available | 752 | Open in IMG/M |
3300005332|Ga0066388_107329259 | Not Available | 554 | Open in IMG/M |
3300005332|Ga0066388_108208762 | Not Available | 521 | Open in IMG/M |
3300005333|Ga0070677_10831933 | Not Available | 529 | Open in IMG/M |
3300005334|Ga0068869_101727079 | Not Available | 559 | Open in IMG/M |
3300005335|Ga0070666_10638645 | Not Available | 778 | Open in IMG/M |
3300005338|Ga0068868_100872354 | Not Available | 816 | Open in IMG/M |
3300005340|Ga0070689_101952856 | Not Available | 536 | Open in IMG/M |
3300005343|Ga0070687_101195485 | Not Available | 560 | Open in IMG/M |
3300005343|Ga0070687_101409207 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300005347|Ga0070668_101970151 | Not Available | 538 | Open in IMG/M |
3300005354|Ga0070675_101729103 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300005364|Ga0070673_100404592 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
3300005367|Ga0070667_101954630 | Not Available | 552 | Open in IMG/M |
3300005367|Ga0070667_102282398 | Not Available | 510 | Open in IMG/M |
3300005367|Ga0070667_102322914 | Not Available | 505 | Open in IMG/M |
3300005438|Ga0070701_10760895 | Not Available | 657 | Open in IMG/M |
3300005438|Ga0070701_11307492 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 518 | Open in IMG/M |
3300005456|Ga0070678_100927976 | Not Available | 797 | Open in IMG/M |
3300005466|Ga0070685_10543507 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300005466|Ga0070685_10841596 | Not Available | 679 | Open in IMG/M |
3300005543|Ga0070672_101380295 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300005544|Ga0070686_100195281 | Not Available | 1447 | Open in IMG/M |
3300005544|Ga0070686_100272321 | Not Available | 1245 | Open in IMG/M |
3300005544|Ga0070686_100425524 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1015 | Open in IMG/M |
3300005544|Ga0070686_100461850 | Not Available | 978 | Open in IMG/M |
3300005544|Ga0070686_100690280 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 813 | Open in IMG/M |
3300005544|Ga0070686_100772794 | Not Available | 772 | Open in IMG/M |
3300005544|Ga0070686_100795082 | Not Available | 762 | Open in IMG/M |
3300005544|Ga0070686_101041707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300005544|Ga0070686_101268568 | Not Available | 614 | Open in IMG/M |
3300005544|Ga0070686_101494372 | Not Available | 569 | Open in IMG/M |
3300005545|Ga0070695_100081102 | Not Available | 2146 | Open in IMG/M |
3300005545|Ga0070695_100130218 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → Phycisphaeraceae → Phycisphaera → Phycisphaera mikurensis | 1733 | Open in IMG/M |
3300005545|Ga0070695_100145190 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1650 | Open in IMG/M |
3300005545|Ga0070695_100260033 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1267 | Open in IMG/M |
3300005545|Ga0070695_101593440 | Not Available | 545 | Open in IMG/M |
3300005564|Ga0070664_101258792 | Not Available | 698 | Open in IMG/M |
3300005564|Ga0070664_101412073 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 658 | Open in IMG/M |
3300005564|Ga0070664_102379217 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 502 | Open in IMG/M |
3300005598|Ga0066706_11316143 | Not Available | 546 | Open in IMG/M |
3300005617|Ga0068859_101463569 | Not Available | 754 | Open in IMG/M |
3300005617|Ga0068859_101597528 | Not Available | 720 | Open in IMG/M |
3300005617|Ga0068859_101676452 | Not Available | 702 | Open in IMG/M |
3300005617|Ga0068859_101694607 | Not Available | 698 | Open in IMG/M |
3300005618|Ga0068864_100344846 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
3300005618|Ga0068864_100393819 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300005618|Ga0068864_100646769 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1029 | Open in IMG/M |
3300005618|Ga0068864_101666716 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300005618|Ga0068864_101832352 | Not Available | 612 | Open in IMG/M |
3300005618|Ga0068864_102413733 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300005660|Ga0073904_10706829 | Not Available | 542 | Open in IMG/M |
3300005719|Ga0068861_101460906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
3300005719|Ga0068861_102127623 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Epitheliaceae → Epithele → Epithele typhae | 561 | Open in IMG/M |
3300005719|Ga0068861_102442317 | Not Available | 526 | Open in IMG/M |
3300005719|Ga0068861_102560460 | Not Available | 514 | Open in IMG/M |
3300005764|Ga0066903_101446616 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300005764|Ga0066903_101929445 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1132 | Open in IMG/M |
3300005764|Ga0066903_102849249 | Not Available | 938 | Open in IMG/M |
3300005764|Ga0066903_102960316 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 920 | Open in IMG/M |
3300005764|Ga0066903_103002319 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300005764|Ga0066903_103320752 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300005764|Ga0066903_103500698 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 846 | Open in IMG/M |
3300005764|Ga0066903_103593013 | Not Available | 835 | Open in IMG/M |
3300005764|Ga0066903_103931077 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 797 | Open in IMG/M |
3300005764|Ga0066903_104174687 | Not Available | 773 | Open in IMG/M |
3300005764|Ga0066903_104259541 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300005764|Ga0066903_104494426 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300005764|Ga0066903_105422213 | Not Available | 673 | Open in IMG/M |
3300005764|Ga0066903_106281049 | Not Available | 621 | Open in IMG/M |
3300005764|Ga0066903_107426791 | Not Available | 566 | Open in IMG/M |
3300005764|Ga0066903_108163592 | Not Available | 536 | Open in IMG/M |
3300005764|Ga0066903_108347535 | Not Available | 529 | Open in IMG/M |
3300005764|Ga0066903_108897401 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300005841|Ga0068863_102011417 | Not Available | 588 | Open in IMG/M |
3300005841|Ga0068863_102383307 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300005843|Ga0068860_101010653 | Not Available | 850 | Open in IMG/M |
3300005843|Ga0068860_101603797 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 673 | Open in IMG/M |
3300005844|Ga0068862_100706565 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → Phycisphaeraceae → unclassified Phycisphaeraceae → Phycisphaeraceae bacterium | 977 | Open in IMG/M |
3300005844|Ga0068862_101517236 | Not Available | 676 | Open in IMG/M |
3300005844|Ga0068862_101874505 | Not Available | 609 | Open in IMG/M |
3300005844|Ga0068862_102221877 | Not Available | 560 | Open in IMG/M |
3300006046|Ga0066652_100619274 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales | 1023 | Open in IMG/M |
3300006417|Ga0069787_10640724 | All Organisms → cellular organisms → Bacteria | 2679 | Open in IMG/M |
3300006417|Ga0069787_12719866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
3300006804|Ga0079221_10767019 | Not Available | 685 | Open in IMG/M |
3300006852|Ga0075433_10349292 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1307 | Open in IMG/M |
3300006852|Ga0075433_10929506 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 758 | Open in IMG/M |
3300006852|Ga0075433_11779480 | Not Available | 530 | Open in IMG/M |
3300006852|Ga0075433_11783472 | Not Available | 529 | Open in IMG/M |
3300006854|Ga0075425_101751344 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300006854|Ga0075425_102520577 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 569 | Open in IMG/M |
3300006871|Ga0075434_101379218 | Not Available | 715 | Open in IMG/M |
3300006871|Ga0075434_101727127 | Not Available | 633 | Open in IMG/M |
3300006880|Ga0075429_101941366 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 510 | Open in IMG/M |
3300006894|Ga0079215_10507511 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 754 | Open in IMG/M |
3300006904|Ga0075424_101620671 | Not Available | 686 | Open in IMG/M |
3300006904|Ga0075424_102342801 | Not Available | 561 | Open in IMG/M |
3300006904|Ga0075424_102449038 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 547 | Open in IMG/M |
3300006904|Ga0075424_102629648 | Not Available | 526 | Open in IMG/M |
3300006969|Ga0075419_11073067 | Not Available | 589 | Open in IMG/M |
3300007004|Ga0079218_11448123 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 738 | Open in IMG/M |
3300009012|Ga0066710_101819830 | Not Available | 918 | Open in IMG/M |
3300009094|Ga0111539_10239406 | Not Available | 2112 | Open in IMG/M |
3300009094|Ga0111539_11050770 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium RAS1 | 947 | Open in IMG/M |
3300009094|Ga0111539_11359682 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300009094|Ga0111539_11396745 | Not Available | 812 | Open in IMG/M |
3300009094|Ga0111539_11494094 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 784 | Open in IMG/M |
3300009094|Ga0111539_11840618 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300009094|Ga0111539_11891528 | Not Available | 692 | Open in IMG/M |
3300009094|Ga0111539_11902424 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium | 690 | Open in IMG/M |
3300009094|Ga0111539_12087888 | Not Available | 657 | Open in IMG/M |
3300009094|Ga0111539_12146493 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales | 648 | Open in IMG/M |
3300009094|Ga0111539_12662547 | Not Available | 580 | Open in IMG/M |
3300009094|Ga0111539_13458800 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 507 | Open in IMG/M |
3300009095|Ga0079224_101148360 | Not Available | 1107 | Open in IMG/M |
3300009095|Ga0079224_102032409 | Not Available | 816 | Open in IMG/M |
3300009095|Ga0079224_104800397 | Not Available | 526 | Open in IMG/M |
3300009143|Ga0099792_10565453 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300009143|Ga0099792_10601448 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300009143|Ga0099792_11044865 | Not Available | 548 | Open in IMG/M |
3300009156|Ga0111538_10174022 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2733 | Open in IMG/M |
3300009156|Ga0111538_10738475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1247 | Open in IMG/M |
3300009156|Ga0111538_10740248 | All Organisms → Viruses → Predicted Viral | 1245 | Open in IMG/M |
3300009156|Ga0111538_10760716 | Not Available | 1227 | Open in IMG/M |
3300009156|Ga0111538_10848919 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1156 | Open in IMG/M |
3300009156|Ga0111538_11145089 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 983 | Open in IMG/M |
3300009156|Ga0111538_11496082 | Not Available | 851 | Open in IMG/M |
3300009156|Ga0111538_11548355 | Not Available | 836 | Open in IMG/M |
3300009156|Ga0111538_11638852 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300009156|Ga0111538_11711759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
3300009156|Ga0111538_11916021 | Not Available | 746 | Open in IMG/M |
3300009156|Ga0111538_12188874 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 695 | Open in IMG/M |
3300009156|Ga0111538_12573108 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 638 | Open in IMG/M |
3300009156|Ga0111538_12608318 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 634 | Open in IMG/M |
3300009156|Ga0111538_13182705 | Not Available | 572 | Open in IMG/M |
3300009156|Ga0111538_13203977 | Not Available | 570 | Open in IMG/M |
3300009156|Ga0111538_14027095 | Not Available | 508 | Open in IMG/M |
3300009156|Ga0111538_14129396 | Not Available | 501 | Open in IMG/M |
3300009162|Ga0075423_10432526 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1382 | Open in IMG/M |
3300009162|Ga0075423_10508857 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300009162|Ga0075423_11069083 | Not Available | 859 | Open in IMG/M |
3300009162|Ga0075423_11478435 | Not Available | 728 | Open in IMG/M |
3300009162|Ga0075423_12134594 | Not Available | 608 | Open in IMG/M |
3300009162|Ga0075423_12292374 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300009162|Ga0075423_12345591 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 581 | Open in IMG/M |
3300009162|Ga0075423_12419150 | Not Available | 573 | Open in IMG/M |
3300009162|Ga0075423_12440575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 570 | Open in IMG/M |
3300009162|Ga0075423_12446533 | Not Available | 569 | Open in IMG/M |
3300009176|Ga0105242_11502324 | Not Available | 704 | Open in IMG/M |
3300009176|Ga0105242_12433901 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → Phycisphaeraceae → Phycisphaera → unclassified Phycisphaera → Phycisphaera sp. | 571 | Open in IMG/M |
3300009177|Ga0105248_11010448 | Not Available | 940 | Open in IMG/M |
3300009177|Ga0105248_11560210 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 748 | Open in IMG/M |
3300009177|Ga0105248_11782154 | Not Available | 698 | Open in IMG/M |
3300009177|Ga0105248_13198856 | Not Available | 521 | Open in IMG/M |
3300009179|Ga0115028_11818728 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300009295|Ga0103747_10166772 | Not Available | 589 | Open in IMG/M |
3300009540|Ga0073899_10254967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1323 | Open in IMG/M |
3300009540|Ga0073899_10385857 | Not Available | 1039 | Open in IMG/M |
3300009540|Ga0073899_10776936 | Not Available | 685 | Open in IMG/M |
3300009540|Ga0073899_10986141 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 593 | Open in IMG/M |
3300009540|Ga0073899_11112432 | All Organisms → cellular organisms → Bacteria → PVC group | 552 | Open in IMG/M |
3300009551|Ga0105238_10800678 | Not Available | 958 | Open in IMG/M |
3300009551|Ga0105238_11018407 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300009551|Ga0105238_12963903 | Not Available | 510 | Open in IMG/M |
3300009553|Ga0105249_12763337 | Not Available | 563 | Open in IMG/M |
3300009553|Ga0105249_12978532 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300009553|Ga0105249_13334448 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300009609|Ga0105347_1375325 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300009609|Ga0105347_1385031 | Not Available | 601 | Open in IMG/M |
3300009609|Ga0105347_1443498 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → Phycisphaeraceae → unclassified Phycisphaeraceae → Phycisphaeraceae bacterium | 561 | Open in IMG/M |
3300010313|Ga0116211_1185909 | Not Available | 538 | Open in IMG/M |
3300010356|Ga0116237_11099795 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300010359|Ga0126376_11910802 | Not Available | 634 | Open in IMG/M |
3300010359|Ga0126376_12029173 | Not Available | 617 | Open in IMG/M |
3300010366|Ga0126379_11786830 | Not Available | 719 | Open in IMG/M |
3300010366|Ga0126379_11906722 | Not Available | 697 | Open in IMG/M |
3300010366|Ga0126379_12193346 | Not Available | 653 | Open in IMG/M |
3300010366|Ga0126379_12537791 | Not Available | 611 | Open in IMG/M |
3300010366|Ga0126379_12644631 | Not Available | 599 | Open in IMG/M |
3300010366|Ga0126379_13525266 | Not Available | 524 | Open in IMG/M |
3300010366|Ga0126379_13693750 | Not Available | 513 | Open in IMG/M |
3300010397|Ga0134124_11516672 | Not Available | 699 | Open in IMG/M |
3300010397|Ga0134124_12410884 | Not Available | 567 | Open in IMG/M |
3300010397|Ga0134124_13062324 | Not Available | 511 | Open in IMG/M |
3300010398|Ga0126383_11106527 | Not Available | 882 | Open in IMG/M |
3300010398|Ga0126383_11560469 | Not Available | 750 | Open in IMG/M |
3300010398|Ga0126383_12818124 | Not Available | 568 | Open in IMG/M |
3300010398|Ga0126383_13115022 | Not Available | 541 | Open in IMG/M |
3300010398|Ga0126383_13492900 | Not Available | 513 | Open in IMG/M |
3300010398|Ga0126383_13651919 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300010400|Ga0134122_10058845 | All Organisms → cellular organisms → Bacteria | 2964 | Open in IMG/M |
3300010400|Ga0134122_10382383 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1237 | Open in IMG/M |
3300010400|Ga0134122_12198825 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 595 | Open in IMG/M |
3300010400|Ga0134122_12205168 | Not Available | 594 | Open in IMG/M |
3300010400|Ga0134122_12361054 | Not Available | 578 | Open in IMG/M |
3300010400|Ga0134122_12468780 | Not Available | 568 | Open in IMG/M |
3300010400|Ga0134122_12766667 | Not Available | 543 | Open in IMG/M |
3300010400|Ga0134122_12954954 | Not Available | 529 | Open in IMG/M |
3300010400|Ga0134122_13082786 | Not Available | 521 | Open in IMG/M |
3300010403|Ga0134123_10868203 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 904 | Open in IMG/M |
3300010403|Ga0134123_11238366 | Not Available | 778 | Open in IMG/M |
3300010403|Ga0134123_11764184 | Not Available | 671 | Open in IMG/M |
3300010403|Ga0134123_12865037 | Not Available | 551 | Open in IMG/M |
3300010403|Ga0134123_13651274 | Not Available | 500 | Open in IMG/M |
3300011439|Ga0137432_1172813 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 697 | Open in IMG/M |
3300011439|Ga0137432_1281037 | Not Available | 533 | Open in IMG/M |
3300011440|Ga0137433_1251370 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 577 | Open in IMG/M |
3300011440|Ga0137433_1287659 | Not Available | 534 | Open in IMG/M |
3300011443|Ga0137457_1100402 | Not Available | 918 | Open in IMG/M |
3300012212|Ga0150985_100621345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → unclassified Streptosporangiaceae → Streptosporangiaceae bacterium NEAU-GS5 | 579 | Open in IMG/M |
3300012212|Ga0150985_105645121 | Not Available | 548 | Open in IMG/M |
3300012212|Ga0150985_110515445 | Not Available | 546 | Open in IMG/M |
3300012212|Ga0150985_118163702 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 513 | Open in IMG/M |
3300012212|Ga0150985_118557232 | Not Available | 734 | Open in IMG/M |
3300012212|Ga0150985_119795601 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1529 | Open in IMG/M |
3300012212|Ga0150985_122820740 | Not Available | 745 | Open in IMG/M |
3300012227|Ga0137449_1153901 | Not Available | 505 | Open in IMG/M |
3300012469|Ga0150984_100333240 | Not Available | 576 | Open in IMG/M |
3300012469|Ga0150984_112410592 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300012469|Ga0150984_115798292 | Not Available | 1232 | Open in IMG/M |
3300012469|Ga0150984_119367856 | Not Available | 636 | Open in IMG/M |
3300012469|Ga0150984_119796605 | Not Available | 682 | Open in IMG/M |
3300012533|Ga0138256_10540961 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 934 | Open in IMG/M |
3300012892|Ga0157294_10131859 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 676 | Open in IMG/M |
3300012893|Ga0157284_10220561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Antrihabitans | 582 | Open in IMG/M |
3300012901|Ga0157288_10336786 | Not Available | 542 | Open in IMG/M |
3300012903|Ga0157289_10416825 | Not Available | 509 | Open in IMG/M |
3300012911|Ga0157301_10428605 | Not Available | 519 | Open in IMG/M |
3300012916|Ga0157310_10549589 | Not Available | 512 | Open in IMG/M |
3300012923|Ga0137359_11398053 | Not Available | 588 | Open in IMG/M |
3300012923|Ga0137359_11501313 | Not Available | 562 | Open in IMG/M |
3300012924|Ga0137413_11409719 | Not Available | 563 | Open in IMG/M |
3300012929|Ga0137404_11882278 | Not Available | 557 | Open in IMG/M |
3300012956|Ga0154020_10027147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6247 | Open in IMG/M |
3300012956|Ga0154020_10041564 | Not Available | 4863 | Open in IMG/M |
3300012956|Ga0154020_10057323 | All Organisms → cellular organisms → Bacteria | 4008 | Open in IMG/M |
3300012956|Ga0154020_10599286 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 902 | Open in IMG/M |
3300012956|Ga0154020_10812828 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 738 | Open in IMG/M |
3300012956|Ga0154020_11244959 | Not Available | 560 | Open in IMG/M |
3300012956|Ga0154020_11274229 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300012956|Ga0154020_11439377 | Not Available | 507 | Open in IMG/M |
3300012971|Ga0126369_10636507 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1139 | Open in IMG/M |
3300012971|Ga0126369_12332590 | Not Available | 621 | Open in IMG/M |
3300012971|Ga0126369_12606740 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 590 | Open in IMG/M |
3300012971|Ga0126369_12848343 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. CCMP2592 | 566 | Open in IMG/M |
3300012971|Ga0126369_12864515 | Not Available | 565 | Open in IMG/M |
3300012971|Ga0126369_12865619 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300012971|Ga0126369_12945899 | Not Available | 557 | Open in IMG/M |
3300012971|Ga0126369_13157454 | Not Available | 540 | Open in IMG/M |
3300012971|Ga0126369_13535210 | Not Available | 512 | Open in IMG/M |
3300012971|Ga0126369_13694443 | Not Available | 501 | Open in IMG/M |
3300013296|Ga0157374_12251913 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 572 | Open in IMG/M |
3300013296|Ga0157374_12269826 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300013297|Ga0157378_12733626 | Not Available | 546 | Open in IMG/M |
3300013306|Ga0163162_12115686 | Not Available | 646 | Open in IMG/M |
3300013308|Ga0157375_11353204 | Not Available | 838 | Open in IMG/M |
3300013308|Ga0157375_12620300 | Not Available | 602 | Open in IMG/M |
3300013308|Ga0157375_13396242 | Not Available | 530 | Open in IMG/M |
3300013308|Ga0157375_13656507 | Not Available | 511 | Open in IMG/M |
3300013502|Ga0119901_1037356 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
3300013502|Ga0119901_1143198 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300013502|Ga0119901_1237344 | Not Available | 548 | Open in IMG/M |
3300013502|Ga0119901_1237357 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300014166|Ga0134079_10304804 | Not Available | 709 | Open in IMG/M |
3300014322|Ga0075355_1050493 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300014322|Ga0075355_1065351 | Not Available | 843 | Open in IMG/M |
3300014322|Ga0075355_1085205 | Not Available | 764 | Open in IMG/M |
3300014325|Ga0163163_11056766 | Not Available | 875 | Open in IMG/M |
3300014325|Ga0163163_11432878 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 752 | Open in IMG/M |
3300014325|Ga0163163_12955669 | Not Available | 530 | Open in IMG/M |
3300014326|Ga0157380_10946490 | Not Available | 891 | Open in IMG/M |
3300014326|Ga0157380_12373269 | Not Available | 595 | Open in IMG/M |
3300014326|Ga0157380_13078091 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300014326|Ga0157380_13244637 | Not Available | 520 | Open in IMG/M |
3300014965|Ga0120193_10047486 | Not Available | 610 | Open in IMG/M |
3300014969|Ga0157376_10850032 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 928 | Open in IMG/M |
3300014969|Ga0157376_11445098 | Not Available | 720 | Open in IMG/M |
3300014969|Ga0157376_11838747 | Not Available | 642 | Open in IMG/M |
3300014969|Ga0157376_12297361 | Not Available | 578 | Open in IMG/M |
3300014969|Ga0157376_12582074 | Not Available | 548 | Open in IMG/M |
3300015200|Ga0173480_10412453 | Not Available | 787 | Open in IMG/M |
3300015200|Ga0173480_10551101 | Not Available | 699 | Open in IMG/M |
3300015200|Ga0173480_10770570 | Not Available | 611 | Open in IMG/M |
3300015200|Ga0173480_11006037 | Not Available | 549 | Open in IMG/M |
3300015200|Ga0173480_11238683 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 506 | Open in IMG/M |
3300015201|Ga0173478_10235365 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 791 | Open in IMG/M |
3300015201|Ga0173478_10298380 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae → Bythopirellula → Bythopirellula polymerisocia | 728 | Open in IMG/M |
3300015371|Ga0132258_12660119 | Not Available | 1249 | Open in IMG/M |
3300015371|Ga0132258_12790716 | Not Available | 1217 | Open in IMG/M |
3300015372|Ga0132256_103563070 | Not Available | 523 | Open in IMG/M |
3300015374|Ga0132255_105110256 | Not Available | 555 | Open in IMG/M |
3300015374|Ga0132255_105325980 | Not Available | 544 | Open in IMG/M |
3300016294|Ga0182041_11465072 | Not Available | 628 | Open in IMG/M |
3300016319|Ga0182033_11177043 | Not Available | 686 | Open in IMG/M |
3300016341|Ga0182035_10496297 | Not Available | 1042 | Open in IMG/M |
3300016404|Ga0182037_11004540 | Not Available | 727 | Open in IMG/M |
3300016422|Ga0182039_11821259 | Not Available | 558 | Open in IMG/M |
3300017792|Ga0163161_11914053 | Not Available | 528 | Open in IMG/M |
3300017792|Ga0163161_12007415 | Not Available | 515 | Open in IMG/M |
3300017936|Ga0187821_10484385 | Not Available | 516 | Open in IMG/M |
3300017974|Ga0187777_11453097 | Not Available | 507 | Open in IMG/M |
3300018482|Ga0066669_11224944 | Not Available | 678 | Open in IMG/M |
3300019263|Ga0184647_1243806 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300019356|Ga0173481_10197709 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300019362|Ga0173479_10543904 | Not Available | 596 | Open in IMG/M |
3300020202|Ga0196964_10627035 | Not Available | 530 | Open in IMG/M |
3300021445|Ga0182009_10512845 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300021475|Ga0210392_11150289 | Not Available | 581 | Open in IMG/M |
3300021475|Ga0210392_11353912 | Not Available | 532 | Open in IMG/M |
3300021475|Ga0210392_11482117 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300024347|Ga0179591_1050937 | Not Available | 2348 | Open in IMG/M |
3300025899|Ga0207642_11019808 | Not Available | 533 | Open in IMG/M |
3300025906|Ga0207699_10275820 | Not Available | 1167 | Open in IMG/M |
3300025918|Ga0207662_10447922 | Not Available | 882 | Open in IMG/M |
3300025924|Ga0207694_11304210 | Not Available | 614 | Open in IMG/M |
3300025925|Ga0207650_10200352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1599 | Open in IMG/M |
3300025925|Ga0207650_11478730 | Not Available | 578 | Open in IMG/M |
3300025926|Ga0207659_11459674 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300025930|Ga0207701_10659073 | Not Available | 888 | Open in IMG/M |
3300025930|Ga0207701_10944049 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 721 | Open in IMG/M |
3300025930|Ga0207701_10986290 | Not Available | 702 | Open in IMG/M |
3300025936|Ga0207670_11476052 | Not Available | 578 | Open in IMG/M |
3300025937|Ga0207669_10828532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 769 | Open in IMG/M |
3300025938|Ga0207704_11694268 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 543 | Open in IMG/M |
3300025939|Ga0207665_11419084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300025940|Ga0207691_10783902 | Not Available | 802 | Open in IMG/M |
3300025940|Ga0207691_11250934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300025941|Ga0207711_10767776 | Not Available | 898 | Open in IMG/M |
3300025941|Ga0207711_11141795 | Not Available | 720 | Open in IMG/M |
3300025942|Ga0207689_11296764 | Not Available | 612 | Open in IMG/M |
3300025960|Ga0207651_10996520 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → Phycisphaeraceae → unclassified Phycisphaeraceae → Phycisphaeraceae bacterium | 749 | Open in IMG/M |
3300025960|Ga0207651_11364582 | Not Available | 638 | Open in IMG/M |
3300026035|Ga0207703_10822402 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300026041|Ga0207639_11123604 | Not Available | 737 | Open in IMG/M |
3300026057|Ga0208294_1013850 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300026057|Ga0208294_1043319 | Not Available | 521 | Open in IMG/M |
3300026075|Ga0207708_10995307 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300026088|Ga0207641_11346273 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 715 | Open in IMG/M |
3300026095|Ga0207676_12138655 | Not Available | 558 | Open in IMG/M |
3300026118|Ga0207675_100147902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2235 | Open in IMG/M |
3300026118|Ga0207675_100716297 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1010 | Open in IMG/M |
3300026118|Ga0207675_100751493 | Not Available | 986 | Open in IMG/M |
3300026118|Ga0207675_101184899 | Not Available | 784 | Open in IMG/M |
3300026118|Ga0207675_101745337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300026118|Ga0207675_102083385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
3300026118|Ga0207675_102139324 | Not Available | 575 | Open in IMG/M |
3300026118|Ga0207675_102278337 | Not Available | 556 | Open in IMG/M |
3300026121|Ga0207683_11440148 | Not Available | 637 | Open in IMG/M |
3300027513|Ga0208685_1133955 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 530 | Open in IMG/M |
3300027573|Ga0208454_1174473 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 500 | Open in IMG/M |
3300027840|Ga0209683_10571904 | Not Available | 515 | Open in IMG/M |
3300027874|Ga0209465_10412991 | Not Available | 676 | Open in IMG/M |
3300027874|Ga0209465_10538445 | Not Available | 582 | Open in IMG/M |
3300027903|Ga0209488_10517556 | Not Available | 873 | Open in IMG/M |
3300027903|Ga0209488_10865950 | Not Available | 636 | Open in IMG/M |
3300027903|Ga0209488_10888415 | Not Available | 625 | Open in IMG/M |
3300028041|Ga0247719_1059069 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1025 | Open in IMG/M |
3300028041|Ga0247719_1060598 | Not Available | 1007 | Open in IMG/M |
3300028041|Ga0247719_1125732 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 619 | Open in IMG/M |
3300028041|Ga0247719_1165924 | Not Available | 514 | Open in IMG/M |
3300028380|Ga0268265_10757863 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300028380|Ga0268265_11623495 | Not Available | 652 | Open in IMG/M |
3300028381|Ga0268264_10964688 | Not Available | 858 | Open in IMG/M |
3300028381|Ga0268264_11078901 | Not Available | 811 | Open in IMG/M |
3300028381|Ga0268264_11176789 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales | 776 | Open in IMG/M |
3300028381|Ga0268264_12475219 | Not Available | 524 | Open in IMG/M |
3300030114|Ga0311333_11796750 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300031232|Ga0302323_102803340 | Not Available | 557 | Open in IMG/M |
3300031232|Ga0302323_103045245 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300031232|Ga0302323_103210539 | Not Available | 521 | Open in IMG/M |
3300031446|Ga0170820_11729818 | Not Available | 753 | Open in IMG/M |
3300031716|Ga0310813_11155125 | Not Available | 712 | Open in IMG/M |
3300031716|Ga0310813_11767584 | Not Available | 580 | Open in IMG/M |
3300031716|Ga0310813_12149999 | Not Available | 528 | Open in IMG/M |
3300031719|Ga0306917_11380094 | Not Available | 544 | Open in IMG/M |
3300031720|Ga0307469_11660545 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300031740|Ga0307468_101443465 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300031879|Ga0306919_10765355 | Not Available | 743 | Open in IMG/M |
3300031902|Ga0302322_103333880 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300031908|Ga0310900_11833099 | Not Available | 517 | Open in IMG/M |
3300031912|Ga0306921_11081932 | Not Available | 900 | Open in IMG/M |
3300031912|Ga0306921_11960902 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 625 | Open in IMG/M |
3300031912|Ga0306921_12430278 | Not Available | 546 | Open in IMG/M |
3300031946|Ga0310910_11512005 | Not Available | 515 | Open in IMG/M |
3300031954|Ga0306926_11725060 | Not Available | 714 | Open in IMG/M |
3300032001|Ga0306922_12334648 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300032008|Ga0318562_10866846 | Not Available | 516 | Open in IMG/M |
3300032013|Ga0310906_11418537 | Not Available | 510 | Open in IMG/M |
3300032039|Ga0318559_10470444 | Not Available | 586 | Open in IMG/M |
3300032059|Ga0318533_10659702 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 768 | Open in IMG/M |
3300032157|Ga0315912_10694656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
3300032261|Ga0306920_101158826 | Not Available | 1119 | Open in IMG/M |
3300032261|Ga0306920_102609528 | Not Available | 693 | Open in IMG/M |
3300032261|Ga0306920_104327466 | Not Available | 510 | Open in IMG/M |
3300032828|Ga0335080_11184112 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Luteolibacter → Luteolibacter ambystomatis | 769 | Open in IMG/M |
3300032828|Ga0335080_11287084 | Not Available | 731 | Open in IMG/M |
3300032828|Ga0335080_11966408 | Not Available | 567 | Open in IMG/M |
3300032828|Ga0335080_12006422 | Not Available | 560 | Open in IMG/M |
3300032828|Ga0335080_12323398 | Not Available | 513 | Open in IMG/M |
3300032829|Ga0335070_10844014 | Not Available | 850 | Open in IMG/M |
3300032829|Ga0335070_10857581 | Not Available | 843 | Open in IMG/M |
3300032955|Ga0335076_10625864 | Not Available | 958 | Open in IMG/M |
3300032955|Ga0335076_11148048 | Not Available | 660 | Open in IMG/M |
3300032955|Ga0335076_11384158 | Not Available | 589 | Open in IMG/M |
3300033158|Ga0335077_11551492 | Not Available | 632 | Open in IMG/M |
3300033488|Ga0316621_10198349 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana | 1248 | Open in IMG/M |
3300034194|Ga0370499_0195629 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 541 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.47% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.47% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.31% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.62% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.46% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.77% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.77% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.54% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.54% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.08% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.62% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.62% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.62% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.39% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.15% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.15% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.15% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.15% |
Activated Sludge | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge | 1.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.69% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.46% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.46% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.46% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.46% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.46% |
Enhanced Biological Phosphorus Removal Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor | 0.46% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.23% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.23% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.23% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.23% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.23% |
Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 0.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.23% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.23% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.23% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.23% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.23% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.23% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.23% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.23% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.23% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.23% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.23% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.23% |
Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 0.23% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
2088090009 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate | Environmental | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006417 | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 | Engineered | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009295 | Microbial communities of wastewater sludge from Singapore - Sludge5_b2_February | Environmental | Open in IMG/M |
3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300010313 | Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Sagole hot spring metaG | Environmental | Open in IMG/M |
3300010356 | AD_USDEca | Engineered | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012227 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2 | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013502 | Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M81612 | Engineered | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026057 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028041 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-1-E_D | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKNP_03495470 | 2070309009 | Soil | VLNVQDFSCFLTRFASGDAYANCDASTAAPVLNVADFSCFLVKYAAGCR |
LWAnN_05841450 | 2088090009 | Freshwater Sediment | DGSTTAPALNVLDFGCFLNLFAAGDAYANCDGSTTPPVLNVLDFGCFLNRFAAGCS |
E41_03184390 | 2170459005 | Grass Soil | DFACFLNRFAAGDPYANCDASTTPPVLNVNDFSCFLNRFAAGCS |
F62_06303680 | 2170459010 | Grass Soil | VNCDRSTTPPILNVNDFSCFLNKFAAGDTYANCDHGYTVPILNVQDFACFLNLFAQGCP |
4PV_01163300 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | VLDFTCFLNRFAAGNTYANCDGSTTPPVLNVLDFGCFLNRFSTGCG |
Ga0062593_1022046161 | 3300004114 | Soil | LAPILNVNDFTCFMTRFAAGDTAANCDGSVAPPVLNVDDYLCFLNRFSAECP* |
Ga0063455_1004257021 | 3300004153 | Soil | NVADFTCFLQKFAASDPYANCDGSTTPPAINVADFTCFLQKFAAGCP* |
Ga0063455_1014807591 | 3300004153 | Soil | GSTIAPALNVLDFNCFINRFAAGESYANCDGSTVAPVLNVLDFNCFLSRYAAGCQ* |
Ga0062589_1012839231 | 3300004156 | Soil | STAPVLNVNDFTCFINRYSAGDSSANCDRSTLPPVLNVGDFTCFLNGYAAGCG* |
Ga0062589_1021125822 | 3300004156 | Soil | PLLSISDYICFLTRFAAADPYANCDNSTQPPTLNIADFICFQSRFISGCP* |
Ga0062590_1011981502 | 3300004157 | Soil | STLAPILNVNDFTCFLNRFAAGDSRANCDGSTAAPVLNVNDFTCFLNAYAAGCS* |
Ga0066671_110256652 | 3300005184 | Soil | PVLNVLDFNCFLNAFSAGNPYANCDGSTTAPVLNVLDFNCFLNRFSAGCP* |
Ga0070690_1010253382 | 3300005330 | Switchgrass Rhizosphere | VCFSNKFAAGDPTANCDGSTVAPVLNVNDFVCFSNKFASGCP* |
Ga0070690_1015935212 | 3300005330 | Switchgrass Rhizosphere | VNDFTCFLNRFAAGDAYANCDGSTTVPVLNVNDFTCFLNKFAAGCP* |
Ga0070690_1017141701 | 3300005330 | Switchgrass Rhizosphere | LNVNDFTCFLNKYAAGDAYANCDGSTLAPVLNVNDFTCFINKYAAGCP* |
Ga0070670_1022703412 | 3300005331 | Switchgrass Rhizosphere | NVNDFTCFLNKYASGDAYANCDGSTTVPTLNVNDFICFNNRFAAGCP* |
Ga0066388_1012822512 | 3300005332 | Tropical Forest Soil | TVSDFGCFLNAFAAGNSYANCDGSTTPPILTVSDFGCFLNAFAAGCS* |
Ga0066388_1013122051 | 3300005332 | Tropical Forest Soil | DFACFLNKFAAGDPYANCDRSTAVPVLNVADFACYLNAFAAGCP* |
Ga0066388_1015849953 | 3300005332 | Tropical Forest Soil | CFLNKFASGDTWANCDGSTTQPVLNVNDFGCFLNAFATGCT* |
Ga0066388_1020970481 | 3300005332 | Tropical Forest Soil | LNVQDFGCFLNQFASGSSYANCDGSTVPPVLTVADFGCFLNSFAAGCP* |
Ga0066388_1028877743 | 3300005332 | Tropical Forest Soil | VADFSCFLNRFSAGDPYANCDGSTNPPTLNVSDFSCFVNAFAAGCS* |
Ga0066388_1039955751 | 3300005332 | Tropical Forest Soil | DFSCFLNRFAAGESYANCDGSTTDPVLNVADFSCFLNAFAAGCS* |
Ga0066388_1073292591 | 3300005332 | Tropical Forest Soil | LNLFTAGHPLANCDASTTPPVLNVADFGCFVNAFGAGCS* |
Ga0066388_1082087621 | 3300005332 | Tropical Forest Soil | LNVADFACFLNRYAAGSVLANCDGSTADPVLNVADFSCFLNRFAAGCQ* |
Ga0070677_108319332 | 3300005333 | Miscanthus Rhizosphere | DFTCFLQKFAAADPYSNCDSSTTAPTLNVLDFTCFLQKFAAACSF* |
Ga0068869_1017270791 | 3300005334 | Miscanthus Rhizosphere | FVCFLNRFGAGDPYANCDNSIAPPVLNVSDFVCFLNRFAAGCS* |
Ga0070666_106386452 | 3300005335 | Switchgrass Rhizosphere | THAPALNVNDFVCFQYRYAAGDHYANCDNSTAAPVLNVNDFICYLNRFAAGCTNP* |
Ga0068868_1008723541 | 3300005338 | Miscanthus Rhizosphere | ADFTCFLQKFAAGDPYANCDQSTIPPVLNVADFTCFLQKFAAGCP* |
Ga0070689_1019528562 | 3300005340 | Switchgrass Rhizosphere | CFLNRYAAADTWANCDGSTNPPVLNVNDFVCYNNAFSAGCP* |
Ga0070687_1011954851 | 3300005343 | Switchgrass Rhizosphere | DFTCFLQKFAAADAYANCDGSTVAPVLNVGDFSCFLQKFAAGCP* |
Ga0070687_1014092072 | 3300005343 | Switchgrass Rhizosphere | ILNVNDFICFNNRFAAGDSFANCDQSTIAPVLNVNDYICFNNLYATGCP* |
Ga0070668_1019701512 | 3300005347 | Switchgrass Rhizosphere | CFNNAYAAGHPYCNCDGSTTPPVLNVNDFMCFTNMFAAGCSVP* |
Ga0070675_1017291031 | 3300005354 | Miscanthus Rhizosphere | VLGAPDFGCFLARFAAGDPYANCDGSTGTPLLNVADFTCFLQKFAAGCP* |
Ga0070673_1004045923 | 3300005364 | Switchgrass Rhizosphere | VADFTCFLQSFASGNAYANCDASTTVPVLNVADFTCFLQKFAAGCP* |
Ga0070667_1019546302 | 3300005367 | Switchgrass Rhizosphere | DASTAQPAMNILDFVCFLNRFGAGDPYANCDNSIAPPVLNVSDFVCFLNRFAAGCS* |
Ga0070667_1022823982 | 3300005367 | Switchgrass Rhizosphere | NVNDFICFNNRFAAGQSYANCDGSTVPPVLNVNDFTCFLNRYAAGCP* |
Ga0070667_1023229142 | 3300005367 | Switchgrass Rhizosphere | GDFTCFLQKYAAANSYANCDNSTQAPVLNVADFTCYLQKYAAGCP* |
Ga0070701_107608952 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | LNVQDFACFLNRYGAADPWANCDGSTVVPVLNVQDFTCFLNRFAAGCP* |
Ga0070701_113074922 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | LNVNDFICFNNLYAAGSSLANCDGSTIVPVLNVNDFNCFTNLYAAGCP* |
Ga0070678_1009279762 | 3300005456 | Miscanthus Rhizosphere | QDFTCFLQKYAAADFYANCDGSTQAPVLNVVDFTCFLQKFAGGCQ* |
Ga0070685_105435071 | 3300005466 | Switchgrass Rhizosphere | LNVGDFTCFLQKYAASDAYANCDGSTTAPVLNVGDFTCFLQKYAAATGCP* |
Ga0070685_108415961 | 3300005466 | Switchgrass Rhizosphere | LDFSCFLQRFAAADLYANCDRSTTAPTLNVLDFTCFLQKFAAGCP* |
Ga0070672_1013802951 | 3300005543 | Miscanthus Rhizosphere | LNVQDFSCFLQKFASANVYANCDNSTQVPTLNVQDFSCFLQKFASGCSAP* |
Ga0070686_1001952812 | 3300005544 | Switchgrass Rhizosphere | CDDSVLPPILNVNDFTCFANRFAAGDPYANCDLSTTPPVLNVNDFTCFLNQFAAGCP* |
Ga0070686_1002723212 | 3300005544 | Switchgrass Rhizosphere | SCFLNRYAAGETLANCDESTIAPVLNVNDFSCFLNRYAAGCP* |
Ga0070686_1004255241 | 3300005544 | Switchgrass Rhizosphere | CFLNKFAAGDSSANCDCGTIAPILNVNDFTCFINRYAVGCPT* |
Ga0070686_1004618501 | 3300005544 | Switchgrass Rhizosphere | LNVNDFICFNNAYAAGHPYCNCDGSTTPPVLNVNDFMCFTNMFAAGCSVP* |
Ga0070686_1006902801 | 3300005544 | Switchgrass Rhizosphere | CFMSEYAHGHSYANCDGSTVAPVLNVNDFVCFSNKFASGCP* |
Ga0070686_1007727942 | 3300005544 | Switchgrass Rhizosphere | VNDFSCFLNRYAAGDSYANCDGSTISPVLNVNDFSCFTNRYAAGCASP* |
Ga0070686_1007950821 | 3300005544 | Switchgrass Rhizosphere | VLNVNDFTCFLNAFAAGSPYANCDQSTTPPVLNVNDFTCFLNTFAAGCP* |
Ga0070686_1010417071 | 3300005544 | Switchgrass Rhizosphere | ALNVADFSCFLQRFAAGDTYANCDQSTAPPVLNVADFSCFLQKFAAGCH* |
Ga0070686_1012685682 | 3300005544 | Switchgrass Rhizosphere | VNDFTCFLNRYAAGEAYANCDGSSAAPVLNVNDFTCFLNRYAAGCP* |
Ga0070686_1014943721 | 3300005544 | Switchgrass Rhizosphere | NVNDFSCFLNSYAAGQTYANCDASTIGPVLNVNDFSCFLNRYAAGCT* |
Ga0070695_1000811023 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | PVLNVGDFTCFLQKYTAGDAYANCDGSTQAPVLNVGDFTCFLQKYTAGCP* |
Ga0070695_1001302181 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LNVADFTCFLQRFAAGDAYANCDNSTAPPVLNVGDFTCFLQRFSAGCP* |
Ga0070695_1001451905 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNVADFTCFLQKFAAADPYANCDGSTTQPVLNVADFTCFLQRFAAGCP* |
Ga0070695_1002600331 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DFTCFLQKFSSNDPYANCDGSITPPILNVADFTCFLQRYAAGCP* |
Ga0070695_1015934402 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | PILNVADFTCFLQRFGDNAPYANCDGSTQPPVLNVADFTCFLQRYSAGCP* |
Ga0070664_1012587921 | 3300005564 | Corn Rhizosphere | TCFLQKFAAADLYANCDSSTAAPVLNVGDFTCFLQKFAGGCN* |
Ga0070664_1014120732 | 3300005564 | Corn Rhizosphere | LNVLDFTCFLQKFAAAAPYANCDSSTTVPTLNVLDFTCFLQKFSAGCN* |
Ga0070664_1023792171 | 3300005564 | Corn Rhizosphere | ILNVNDFACFLNVFAAGNPLANCDGSTLPPVLNVNDFQCFLNTFAAGCP* |
Ga0066706_113161431 | 3300005598 | Soil | RFAAGDSYANCDLSSTTPILNISDSICFQTAFAAGCR* |
Ga0068859_1014635691 | 3300005617 | Switchgrass Rhizosphere | PPVLNVNDFQCFLNRFSASHPYANCDGSTEPPVLNVNDFQCFLNRYAAGCP* |
Ga0068859_1015975282 | 3300005617 | Switchgrass Rhizosphere | FTCFLNTFAAGSTDANCDASTIPPILNVNDFTCFLNLFAAGCP* |
Ga0068859_1016764521 | 3300005617 | Switchgrass Rhizosphere | SQIPPILNVNDFSCFLGRFAAGLSEANCDASTLQPILNVSDFACFLNKYALGCP* |
Ga0068859_1016946072 | 3300005617 | Switchgrass Rhizosphere | LNRFAAGDSYANCDGSTIPPAMNVNDFVCFNNRFASGCP* |
Ga0068864_1003448461 | 3300005618 | Switchgrass Rhizosphere | PILNVNDFVCFNNRFAAGDTWANCDGSTTAPILNVNDFVCFNNRFAAGCR* |
Ga0068864_1003938191 | 3300005618 | Switchgrass Rhizosphere | LNVNDFVCFLNRFSAGDSYANCDNSTSAPVLNVNDFTCFLNKYAVGCP* |
Ga0068864_1006467691 | 3300005618 | Switchgrass Rhizosphere | IAPVLNVNDFSCFLNSYAAGQTYANCDASTIAPVLNVNDFSCFLNRYAAGCT* |
Ga0068864_1016667162 | 3300005618 | Switchgrass Rhizosphere | ALNINDFTCFLNQFAASDSRANCDNSTSPPVLNVNDFTCFLNRFAAGC* |
Ga0068864_1018323521 | 3300005618 | Switchgrass Rhizosphere | LNVNDFTCFLNQFAAGSQYANCDNSTLEPTLNVNDFSCFLNRFAASCP* |
Ga0068864_1024137331 | 3300005618 | Switchgrass Rhizosphere | NVSDFICFLNRYAAADPYANCDNSTLPPVLNVNDFICFQQRFAAGCG* |
Ga0068864_1025967091 | 3300005618 | Switchgrass Rhizosphere | CFMTRFAAGDTAANCDGSVAPPVVNVDDYLCFLNRFSAGCP* |
Ga0073904_107068291 | 3300005660 | Activated Sludge | FICFLNRFAAADPWANCDASTNPPVLNVNDFVCFNNAFVGGCP* |
Ga0068861_1014609062 | 3300005719 | Switchgrass Rhizosphere | TPQLNVNDFICFNNRFAAADPYANCDSSTVAPVLNVNDFTCFLNRYAAGCP* |
Ga0068861_1021276231 | 3300005719 | Switchgrass Rhizosphere | DFTCFLQRFASADPYANCNASTQPPTLNVADFSCFLQKYAAGCP* |
Ga0068861_1024423172 | 3300005719 | Switchgrass Rhizosphere | VLNVNDFTCFLNRYAAGSPSANCDGSTTPPVLNVNDFTCFLNRYAVGCT* |
Ga0068861_1025604602 | 3300005719 | Switchgrass Rhizosphere | SDFVCFLNAYAAGLSSANCDGSTAAPVLNVGDFICFMNAYAAGCST* |
Ga0066903_1014466162 | 3300005764 | Tropical Forest Soil | LNVADFSCFLNSFAAGSSYANCDASTTPPVLNVADFSCFLNAFAAGCT* |
Ga0066903_1019294451 | 3300005764 | Tropical Forest Soil | SDFACFLNRFAAGSAYANCDGSTAAPALTVSDFACFLNRFAAGCG* |
Ga0066903_1028492491 | 3300005764 | Tropical Forest Soil | DFACFLNRFAAGSPYANCDGSTAPPVLNIADFSCFLSAFAAGCS* |
Ga0066903_1029603161 | 3300005764 | Tropical Forest Soil | AGDTYANCDGSTTAPVLNVQDFLCFINRFSAGCSGP* |
Ga0066903_1030023191 | 3300005764 | Tropical Forest Soil | FTCFLNRFAAGDAYANCDGSTTTPVLNVGDFSCFVNAFAAGCP* |
Ga0066903_1033207522 | 3300005764 | Tropical Forest Soil | IADFACFLDRFASGNSYANCDGSTTPPIINVADFTCFLQRFAAGCP* |
Ga0066903_1035006982 | 3300005764 | Tropical Forest Soil | TTPPILNIGDYVCFLNRFNAGSSYANCDGSTTPPVLNVGDFTCFLNRFNAGCT* |
Ga0066903_1035930132 | 3300005764 | Tropical Forest Soil | DFGCFLNRYAAGDAYANCDGSTAPPVLTVADFGCFLNLYAAGCSGC* |
Ga0066903_1039310771 | 3300005764 | Tropical Forest Soil | FAAGDSYANCDGSTTPPVLNVTDFACFLNRVSAGC* |
Ga0066903_1041746871 | 3300005764 | Tropical Forest Soil | VADFACFLNRFAAGDSYANCDNSTAPPVLNVADFACFLNAFAAGCS* |
Ga0066903_1042595411 | 3300005764 | Tropical Forest Soil | ADFSCFLNRFAAGDPYANCDGSTIPPVLNVSDFSCFLNMFAAGCP* |
Ga0066903_1044944261 | 3300005764 | Tropical Forest Soil | AFLGQFAAGSLQANCDGSTTPPMLNVNDFLCFISRFGAGCS* |
Ga0066903_1054222131 | 3300005764 | Tropical Forest Soil | VLNVADFSCFLNRFAAGDSYANCDHSTAAPVLNVADFACFLNAFAAGCS* |
Ga0066903_1062810492 | 3300005764 | Tropical Forest Soil | ADFACFLNRFAAADPVANCDGSTIAPSLNARDFACFLNQFATACP* |
Ga0066903_1074267912 | 3300005764 | Tropical Forest Soil | SRFAAGDSYANCDGSTSAPSLTVNDFICFQAAFAAGCP* |
Ga0066903_1081635921 | 3300005764 | Tropical Forest Soil | VPVLNVADFACFINAFTSGSGYANCDHSTIPPVLNVVDFSCFLNAFAAGCS* |
Ga0066903_1083475352 | 3300005764 | Tropical Forest Soil | CFLQRFAAGDPYANCDNSTEPPVLNVADFTCFLRRFAEGCP* |
Ga0066903_1088974012 | 3300005764 | Tropical Forest Soil | DFSCFMNRFAAGDSLANCDGSTVSPVLNISDFSCFLNVFAAGCS* |
Ga0068863_1020114172 | 3300005841 | Switchgrass Rhizosphere | FNNRFAAGDSYANCDQSTFPPVLNVNDFSCFMNKYAVGCP* |
Ga0068863_1023833071 | 3300005841 | Switchgrass Rhizosphere | PILNVNDFTCFLNKFAAGDSAANCDGSSTAPILNVNDFTCFLNKFAVGCP* |
Ga0068860_1010106531 | 3300005843 | Switchgrass Rhizosphere | NDFNCFLSKFAAGDPYANCDGSTAPPQLNVSDFICFGNRFAAGCP* |
Ga0068860_1016037972 | 3300005843 | Switchgrass Rhizosphere | STAPPILNANDFMCFLNRFSAGDPEADCDLSTAPPILNVNDFACFLNRFVVGCN* |
Ga0068862_1007065652 | 3300005844 | Switchgrass Rhizosphere | LNVNDYVCFNNRFAAGDSYANCDQSTNVPLLNVNDYVCFNNRFAAGCP* |
Ga0068862_1015172361 | 3300005844 | Switchgrass Rhizosphere | CFLNRFAAGDPYANCDGSTSAPVLNVYDFVCFQERFAAGCN* |
Ga0068862_1018745052 | 3300005844 | Switchgrass Rhizosphere | AQSPYANCDGSTAWPYLNVTDFVCFTNRYATGCP* |
Ga0068862_1022218771 | 3300005844 | Switchgrass Rhizosphere | NVNDFSCFLNRYAAGDSGANCDNSTINPVLNVNDFSCFLNQYAAGCP* |
Ga0066652_1006192741 | 3300006046 | Soil | DFACFLARFAAGDGYANCDSSTAAPVLNVADVTCFVQKFAAGCP* |
Ga0069787_106407243 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | QCFLNLFAANDPYANCDGSTGDPALTANDFQCFLNKYAVGCP* |
Ga0069787_127198661 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | PLLTANDFQCFLNKYAAGDTYANCDQSTGIPALTANDFQCFLNAYAAGCQ* |
Ga0079221_107670191 | 3300006804 | Agricultural Soil | NVQDFGCFLGRMASGDSYANCDGSTSPPILTVSDFGCYLNAFAAGCGS* |
Ga0075433_103492921 | 3300006852 | Populus Rhizosphere | VSDFACFLNRFAAGSAYANCDGSTGTPALTVSDFACFLNRFAAGCP* |
Ga0075433_109295061 | 3300006852 | Populus Rhizosphere | CFLNRFFAGDSYANCDGSTVPPVLNVSDFGCFLNRFSVGCT* |
Ga0075433_117794801 | 3300006852 | Populus Rhizosphere | DFTCFLNRFFAGSPYANCDHSTTPPVLNPLDFTCFLNQFAAGCP* |
Ga0075433_117834722 | 3300006852 | Populus Rhizosphere | CFLNRFAAGDSYANCDNSTAPPVLNVADFSCFLNAFAAGCP* |
Ga0075425_1017513442 | 3300006854 | Populus Rhizosphere | LNRYAAGSVLATCDGSTTEPVLNVADFSCFLNAFAAGCP* |
Ga0075425_1025205772 | 3300006854 | Populus Rhizosphere | QDFSCYLNKFAAGDPFANCDGSTTPPVLNVQDFSCFLNRFAAGCS* |
Ga0075434_1013792182 | 3300006871 | Populus Rhizosphere | FTAGDPYANCDGSTAPPVLTIADFACFLSGFAAGCT* |
Ga0075434_1017271271 | 3300006871 | Populus Rhizosphere | NCDASTTPPVLNIADFSCFLNSFAAGDSYANCDHSTTAPVLNVADFSCFLNAFASGCN* |
Ga0075429_1019413661 | 3300006880 | Populus Rhizosphere | CFLNEFAAGNSYANCDGSTTIPVLTVQDFGCFLNSFAAGCGTNC* |
Ga0079215_105075111 | 3300006894 | Agricultural Soil | FTCFLQRYAAGESYANCDNSTTAPVLNVQDFTCFLQRYATGCP* |
Ga0075424_1016206712 | 3300006904 | Populus Rhizosphere | NVGDFSCFLNAFAAGDPYANCDQSTQPPVLNVSDFACFLNRFAAGCP* |
Ga0075424_1023428012 | 3300006904 | Populus Rhizosphere | TVPVLTVLDFSCLLNRCFAGDPYANCDGSTTAPVLNVQDFGCFLNSFATGCS* |
Ga0075424_1024490381 | 3300006904 | Populus Rhizosphere | TLAPVLNVNDFSCFLNRFNQGDSYANCDQSTTPPVLNVSDFGCFLNRFVAGCT* |
Ga0075424_1026296481 | 3300006904 | Populus Rhizosphere | DFACFLNRFAAGASYANCDGSTANPVLNVADFACFLNRFAAGCN* |
Ga0075419_110730672 | 3300006969 | Populus Rhizosphere | FVNKFGAADPYANCDQSTTAPTLNVLDFQCFLNKFQVGCS* |
Ga0079218_114481231 | 3300007004 | Agricultural Soil | FLQRYAFGAYYANCDRSTTPPTLNVADFTCFLQKYAAGCP* |
Ga0066710_1018198301 | 3300009012 | Grasslands Soil | TTSPILNVLDFTCFLNKFAAADPYANCDGSTTPPTLNVLDFTCFLNRFAAGCS |
Ga0111539_102394061 | 3300009094 | Populus Rhizosphere | PVLNVNDFQCFLNRFSASHPYANCDGSTEPPVLNVNDFQCFLNRYAAGCP* |
Ga0111539_110507702 | 3300009094 | Populus Rhizosphere | PLLNVNDFTCFLNKYAAGDAYANCDGSTAAPVLNVNDFTCFLNRFAVGCP* |
Ga0111539_113596823 | 3300009094 | Populus Rhizosphere | CFLTRFSLRDPYANCDGSTVPPVLNVNDFSCFMNKFAAGCS* |
Ga0111539_113967451 | 3300009094 | Populus Rhizosphere | AADFTCFLNSFASGTTYANCDASTTPPALNVADFTCFLNSFSAGCS* |
Ga0111539_114940942 | 3300009094 | Populus Rhizosphere | VLNIQDFGCFLNKFASGELSANCDGSTTPPVLNILDFGCFLNRFAIGCP* |
Ga0111539_118406181 | 3300009094 | Populus Rhizosphere | KFAGGDSYANCDGSTTAPTLNVQDFACFLNLFAAGCS* |
Ga0111539_118915281 | 3300009094 | Populus Rhizosphere | NKYAASDSYANCDGSTLVPILNVNDFSCFLNRFAAGCP* |
Ga0111539_119024242 | 3300009094 | Populus Rhizosphere | QDFACFLNRFAAGSTLANCDGSTTAPMLNVQDFACFLNRFAAGCP* |
Ga0111539_120878882 | 3300009094 | Populus Rhizosphere | FLNKYAAGDPYANCDESTAAPALNVGDFACFLNKYAAGCP* |
Ga0111539_121464932 | 3300009094 | Populus Rhizosphere | PTLNVQDFSCFLNSFASGETYANCDLSTTPPVLNVQDFSCFLNAFASGCT* |
Ga0111539_126625471 | 3300009094 | Populus Rhizosphere | CFLNKFASSDTYANCDFSTTPPVLNVQDFACFLNAFSSGCS* |
Ga0111539_134588002 | 3300009094 | Populus Rhizosphere | DFACFLNRFASGDSRANCDGSTTPPVLNVIDFSCFLLAYAQGCP* |
Ga0079224_1011483601 | 3300009095 | Agricultural Soil | QAAFAAGDPYANCDGSTVAPVLNVNDFICFQAAFAQGCP* |
Ga0079224_1020324091 | 3300009095 | Agricultural Soil | QARFAAGDPYANCDGSTVPPVLNVNDFICFQVAFAAGCP* |
Ga0079224_1048003971 | 3300009095 | Agricultural Soil | STVAPVLNVNDFICFQAAFAAGDPYANCDGSTVAPVLNVNDFICFQAAFAQGCP* |
Ga0099792_105654532 | 3300009143 | Vadose Zone Soil | RKFATADPYANCNVDQTIDVADFTCFLQKFVAGCP* |
Ga0099792_106014481 | 3300009143 | Vadose Zone Soil | RPHSSTSFDFNCFLQKFAVGDLYANCDRSTAPPLLNVLDFTCFLQKFAAGCP* |
Ga0099792_110448651 | 3300009143 | Vadose Zone Soil | VADFACFLQKYAASDPYANCDASTTPPTLNITDFTCFLQKFAVGCP* |
Ga0105243_128370582 | 3300009148 | Miscanthus Rhizosphere | YPNCDDSTIDPILNIQDFACFLNKFASGDTWANCDLSTTAPVLNVQDFSCFLNTFAAGCAD* |
Ga0111538_101740221 | 3300009156 | Populus Rhizosphere | NVNDFICFNNLFAAGDSNANCDASTTPPVLNVNDFTCFLNAYAAGCGR* |
Ga0111538_107384751 | 3300009156 | Populus Rhizosphere | AGDTYANCDASTAVPVLNVQDFTCFLNRFTVGCP* |
Ga0111538_107402482 | 3300009156 | Populus Rhizosphere | FLNAFAAGSPYANCDQSTTPPVLNVNDFTCFLNTFAAGCP* |
Ga0111538_107607161 | 3300009156 | Populus Rhizosphere | STIAPVLNVNDFSCFLNRYAAGDTYANCDASTIAPVLNVNDFSCFLNSYAAGCP* |
Ga0111538_108489191 | 3300009156 | Populus Rhizosphere | ICFNNLYAAGDSRANCDGSTVAPVLNVNDFTCFTNKYAVGCP* |
Ga0111538_111450891 | 3300009156 | Populus Rhizosphere | IADFICFLNRFSSGATYANCDNSTANPVLNIADFNCFLNKFTTGCS* |
Ga0111538_114960821 | 3300009156 | Populus Rhizosphere | NRYAAGDPAANCDQSTAAPTLNVNDYTCFLNQYAAGCP* |
Ga0111538_115483553 | 3300009156 | Populus Rhizosphere | CFLNDYAAGSLKANCDHSTSPPVLNVNDFTCFANMFAAGCE* |
Ga0111538_116388521 | 3300009156 | Populus Rhizosphere | PILNVQDFTCFLNRFASADPYANCDGSTIPPVLNVQDFTCFLNRFAAGCP* |
Ga0111538_117117592 | 3300009156 | Populus Rhizosphere | LNRFGAGDPYANCDASTSAPILNVNDFTCFLNKYAVGCP* |
Ga0111538_119160211 | 3300009156 | Populus Rhizosphere | ILNVGDFICFLNRFAAGDSYANCDGTSLPPILSISDFICFTNRFAAGCL* |
Ga0111538_121888741 | 3300009156 | Populus Rhizosphere | APILNVQDFSCFLNAFAAGLSYSNCDGSTTAPVLNVQDFACFLNLFAQGCP* |
Ga0111538_125731082 | 3300009156 | Populus Rhizosphere | LNKFASGDPYANCDGSTVPPVLNIADFSCFVNKFAAGCN* |
Ga0111538_126083181 | 3300009156 | Populus Rhizosphere | AAGNSYANCDASTIVPTLNINDFICFNNRFAGGCP* |
Ga0111538_131827052 | 3300009156 | Populus Rhizosphere | FNNLYATGSSLANCDGSTIAPVLNVNDFTCFLNKYAAGCP* |
Ga0111538_132039771 | 3300009156 | Populus Rhizosphere | NINDYVCFLARYAQGASSANCDGSTLPPVLNVNDFVCFQARYAQGCL* |
Ga0111538_140270951 | 3300009156 | Populus Rhizosphere | NCDNSTIVPCLNVQDFGCFLNKFASNDTYANCDSSTIPPVLNVQDFGCFLNKFATGCSAC |
Ga0111538_141293962 | 3300009156 | Populus Rhizosphere | NRFAANDSRANCDGSTAFPELNILDFNCFLNQFASACP* |
Ga0075423_104325263 | 3300009162 | Populus Rhizosphere | IADFACFLNHFAAGDVYANCDACSWCSPPVLNVLDFACFLNRFAAGCS* |
Ga0075423_105088571 | 3300009162 | Populus Rhizosphere | NKFAAADPWANCDGSTTTPVLNVSDFACFLNQFAAGCP* |
Ga0075423_110690831 | 3300009162 | Populus Rhizosphere | LNAFAAGDPYANCDESVTSPVLTVADFGCFLNAFAAGCP* |
Ga0075423_114784354 | 3300009162 | Populus Rhizosphere | VPVLNISDFACFLNRFAAGDSYANCDNSTTPPVLNVSDFACFLNRFAAGCT* |
Ga0075423_121345941 | 3300009162 | Populus Rhizosphere | FLNHFAAGDEYANCDKSCQEPRLTVADFACFLNAFAAGCP* |
Ga0075423_122923741 | 3300009162 | Populus Rhizosphere | IAPVLNIADFGCFLNRFANSDPWANCDGSTIAPVLNIADFGCFLNRFSSGCS* |
Ga0075423_123455912 | 3300009162 | Populus Rhizosphere | QDFACFLNAFAMQDPYANCDASTVAPTLNVQDFACFLNKFAAGCP* |
Ga0075423_124191502 | 3300009162 | Populus Rhizosphere | SCFLNRFAAGDSYANCDASTTPPVLNVADFSCFLNAFAAGCS* |
Ga0075423_124405751 | 3300009162 | Populus Rhizosphere | VAPVLNVQDFACFLNRFAAGESAANCDQSTSPPVLNVQDFSCFLNSFAAGCS* |
Ga0075423_124465332 | 3300009162 | Populus Rhizosphere | SCFLNRFAAGDSRANCDGSTTPPTLNVSDFACFLNRFAAGCQ* |
Ga0105242_115023242 | 3300009176 | Miscanthus Rhizosphere | VQDFSCFLQKYASADSYANCDGSTQVPVLNVQDFSCFLQKYASGCN* |
Ga0105242_124339011 | 3300009176 | Miscanthus Rhizosphere | ADFTCFLQRYAAGDLYANCDGSTTPPVLNVADFTCFLQRYAVGCP* |
Ga0105248_110104481 | 3300009177 | Switchgrass Rhizosphere | APVLNVNDFTCFANKYAASDPYANCDGSTIAPVLNVNDFTCFLNQYAAGCP* |
Ga0105248_115602101 | 3300009177 | Switchgrass Rhizosphere | AAGDSYANCDGSTAAPVLNVNDFICFQQRFAAGCP* |
Ga0105248_117821542 | 3300009177 | Switchgrass Rhizosphere | VCFQNLYAAGSAAANCDGSTTAPVLNVNDFICFQNLYAAGCP* |
Ga0105248_131988561 | 3300009177 | Switchgrass Rhizosphere | YAANDPYANCDGSTTPPVLNVADFTCFLQKYAAGCP* |
Ga0115028_118187282 | 3300009179 | Wetland | GDSYANCDGSTIAPVLNVNDFSCFTNKYAAGCAAP* |
Ga0103747_101667722 | 3300009295 | Wastewater Sludge | DFSCFLNKYAANDPYANCDGSTIAPVLNVNDFSCFLNKFAAGCP* |
Ga0073899_102549671 | 3300009540 | Activated Sludge | ANDFQCFLNKFAAGDVGANCDHSTSLPMLTANDFQCFLNAFAAGCS* |
Ga0073899_103858571 | 3300009540 | Activated Sludge | DFQCFMNLYAAQDPRANCDNSSSPPVLNVNDFQCFLNTYAVGCS* |
Ga0073899_107769362 | 3300009540 | Activated Sludge | LLTANDFQCFLNAFAAGQSTANCDNSSTAPALTANDFQCFLNSFAAGCS* |
Ga0073899_109861412 | 3300009540 | Activated Sludge | LTANDFQCFLNNFAAANPYANCDGSTNIPTLTANDFQCYLNAYAAGCS* |
Ga0073899_111124321 | 3300009540 | Activated Sludge | LNVNDFQCFLNKFATNDPYANCDKSTAEPVLNANDFQCYLNKYAAGCH* |
Ga0105238_108006782 | 3300009551 | Corn Rhizosphere | VCFQAAFAAGDPYANCDGSTSPPTLTVNDFVCFQAAFAAGCP* |
Ga0105238_110184071 | 3300009551 | Corn Rhizosphere | LNVNDFVCFLNRFAAGESSANCDGSTAAPALNVNDFVCFLNRYAEGCG* |
Ga0105238_129639031 | 3300009551 | Corn Rhizosphere | NRYAAGESYANCDASTNPPILNVNDFICFTNAFAVGCP* |
Ga0105249_127633371 | 3300009553 | Switchgrass Rhizosphere | ILNVNDFACFLNRYVSGDAWANCDGSTTAPVLNINDFSCFINRYAAGCP* |
Ga0105249_129785321 | 3300009553 | Switchgrass Rhizosphere | LNVNDFICFNNRFAAGDSFANCDQSTIAPVLNVNDYICFNNLYATGCP* |
Ga0105249_133344481 | 3300009553 | Switchgrass Rhizosphere | LPPVLNVNDFTCFLNRYAAADPYANCDGSTLSPVLNVNDFTCFLNKFAAGCP* |
Ga0105347_13753251 | 3300009609 | Soil | TANDFQCFLDAFAAGQNYANCDGSTNEPTLTANDFQCFLNAYAAGCS* |
Ga0105347_13850311 | 3300009609 | Soil | DFSSNPPILTANDFQCFLDAFAAGQIYANCDDSSNQPILTANDFQCFLNAFAAGCP* |
Ga0105347_14434981 | 3300009609 | Soil | RFAAGSSLANCDQSTTQPTLTANDFQCFLNAFAAGCS* |
Ga0116211_11859091 | 3300010313 | Hot Spring | NDFQCFLNKFAANDTYANCDGSTGTPLLTANDFQCFLNKFAAGCS* |
Ga0116237_110997952 | 3300010356 | Anaerobic Digestor Sludge | CDGSMTPPVLNVMDFVCFLNRFAAGESYANCDASTTPPVLNISDFVCFLNAFAAGCS* |
Ga0126376_119108021 | 3300010359 | Tropical Forest Soil | SCFLNRFAAGDTYANCDQSTTPPVLNVADLSCFLNAFAAGCS* |
Ga0126376_120291732 | 3300010359 | Tropical Forest Soil | VSDFGCFLNRYAAGSSYANCDGSTSPPVLTVQDFGCFLNAYSAGCGTNC* |
Ga0126379_117868301 | 3300010366 | Tropical Forest Soil | LDFTCFLNRFAAGDSYANCDGSTIPPVLNVADFSCFLNAFGAGCS* |
Ga0126379_119067222 | 3300010366 | Tropical Forest Soil | VLNVLDFGCFLNKFAAGEPYANCDGSTSPPILNVLDFACFLNHFAAGCS* |
Ga0126379_121933462 | 3300010366 | Tropical Forest Soil | APILSVLDFSCFLNRFAARSPYANCDGSTTPPTLNVLDFTCFLNQFAAGCS* |
Ga0126379_125377912 | 3300010366 | Tropical Forest Soil | FAAGDTYANCDQSTTPPVLNVLDFNCFLNQFAAGCSGC* |
Ga0126379_126446311 | 3300010366 | Tropical Forest Soil | NDFQCFLNRFAAGDLYANCDGSTMPPVLNVQDFDCFLNQFAAGCP* |
Ga0126379_135252661 | 3300010366 | Tropical Forest Soil | TTPPVLNIADFACFLNRFFAGDAYANCDGSTTEPVLNVSDFTCFLNRFAAGCN* |
Ga0126379_136937502 | 3300010366 | Tropical Forest Soil | ASTTPPILNVADFACFLNRFAAGSSYANCDGSTNPPVLNVADFACFLNRFAAGCN* |
Ga0134124_115166722 | 3300010397 | Terrestrial Soil | TVNDFVCFQSRFAAGDSWANCDGSTTAPLLNVNDFICFQSAFAAGCP* |
Ga0134124_124108841 | 3300010397 | Terrestrial Soil | PILNINDFICFTNRFAAGDSYANCDASTAAPILNVNDFVCFTNRFAAGCR* |
Ga0134124_130623241 | 3300010397 | Terrestrial Soil | NVADFGCFLNRFQAGDSYANCDGSTLVPVLNVADFGCFLNRFANGCP* |
Ga0126383_111065272 | 3300010398 | Tropical Forest Soil | LNVLDFGCFLNKFATGDPYANCDGSTATPVLNVLDFSCFLNRFAAGCS* |
Ga0126383_115604691 | 3300010398 | Tropical Forest Soil | FVCFLNSFGAGASYANCDGSTTPPVLNINDFTCFLNQFAAGCS* |
Ga0126383_128181242 | 3300010398 | Tropical Forest Soil | AGDSYANCDGSTTPPTLNVLDFNCFLNRFAAGCS* |
Ga0126383_131150222 | 3300010398 | Tropical Forest Soil | CFLNRFAAFDPYANCDQKTTPPVLNVQDFNCFLNKFAAGCS* |
Ga0126383_134929001 | 3300010398 | Tropical Forest Soil | NRFAAGDPYANCDGSTTPPVLNVLDFTCFLNTFAAGCP* |
Ga0126383_136519192 | 3300010398 | Tropical Forest Soil | ACFLNRFAAGDSRANCDGSTTTPELNVADFGCFINAFTAGCP* |
Ga0134122_100588455 | 3300010400 | Terrestrial Soil | DFTCFLSKYAANDPYANCDNSTQAPVLNVADFTCFLSKYAAGCP* |
Ga0134122_103823832 | 3300010400 | Terrestrial Soil | ASVTPPVLNVADFACFLQRFSEGDPYANCDGSITPPVLNVADFTCFLQRYVTGCP* |
Ga0134122_121988251 | 3300010400 | Terrestrial Soil | ALSAADFSCFLQRFSQGDPYSNCDNSTTPPTLNVADFTCFLRWFAGGCP* |
Ga0134122_122051682 | 3300010400 | Terrestrial Soil | TCFLSRYAASDPWANCDGSTQSPVLNIGDFTCFLSRYAAGCP* |
Ga0134122_123610541 | 3300010400 | Terrestrial Soil | SGTAPVLNVADFTCFLTKFAAGDPWANCDASVQAPVLNVADFTCFLTKYAAGCP* |
Ga0134122_124687802 | 3300010400 | Terrestrial Soil | YAAGDSYANCDGSTAAPTVNIADFTCFLQRFSAGCSIP* |
Ga0134122_127666671 | 3300010400 | Terrestrial Soil | PILNVADFTCFLTKYAAGDSYANCDASTAAPVLNVADFTCFLTKYAAGCSR* |
Ga0134122_129549542 | 3300010400 | Terrestrial Soil | LNVADFTCFLTKYASGDAYANCDGSTQAPILNVADFTCFLTKYASGCSAP* |
Ga0134122_130827862 | 3300010400 | Terrestrial Soil | CFLTKYAANDAYANCDASTQPPVLNVADFTCFLTKYAAGCP* |
Ga0134123_108682031 | 3300010403 | Terrestrial Soil | TANDFQCFLNQFAQATAYANCDGSTATPLLTANDFQCFLNKYAQGCS* |
Ga0134123_112383662 | 3300010403 | Terrestrial Soil | FQCFLNAFSTGFPYANCDGSTVAPTLTANDFQCFLNAFSEGCP* |
Ga0134123_117641842 | 3300010403 | Terrestrial Soil | TTNPILTANDFQCFLNAYAANDPYANCDLSTSIPILTANNFQCFLNAYAAGCS* |
Ga0134123_128650372 | 3300010403 | Terrestrial Soil | DFTCFLNRFAAGESFANCDASTVAPVLNVNDFTCFLNRYAVGCT* |
Ga0134123_136512742 | 3300010403 | Terrestrial Soil | FTCFLNAFAAGSPYANCDQSTTPPVLNVNDFTCFLNTFAAGCP* |
Ga0137432_11728131 | 3300011439 | Soil | ATPILTANDFQCFLDRFAAGQIYANCDQSTGAPTLTANDFQCFLNAFAAGCS* |
Ga0137432_12810371 | 3300011439 | Soil | AAGQSYANCDGSTAAPLLTPNDFQCFLNRYASGC* |
Ga0137433_12513702 | 3300011440 | Soil | LDKFAAGDPYANCDGSTAIPKLTANDFQCYLNAFAAGCT* |
Ga0137433_12876591 | 3300011440 | Soil | NDFQCFLDAFAAGQIYANCDDSSNQPILTANDFQCFLNAFAAGCP* |
Ga0137457_11004023 | 3300011443 | Soil | VLTANDFVCFLEAYATASSYANCDGSTVAPVLTANDFVCFVSQYAIGCS* |
Ga0150985_1006213451 | 3300012212 | Avena Fatua Rhizosphere | FNCFLNRFSAGDSYANCDHSTVAPVLNVLDFNCFLNAFSQGCSAP* |
Ga0150985_1056451211 | 3300012212 | Avena Fatua Rhizosphere | APPILNMMDFNCFLDRFAAGDSYANCDGSTIAPVLNVLDFNCFLNTFAAGCP* |
Ga0150985_1105154452 | 3300012212 | Avena Fatua Rhizosphere | NVLDFNCFLNAFAAGAPYANCDHSTIAPVLNVLDFNCFLNQFSAGCP* |
Ga0150985_1181637022 | 3300012212 | Avena Fatua Rhizosphere | VADFTCFLQHFAGGDPYANCDAGTVPPVLNVADFTCFLQRYAAGCP* |
Ga0150985_1185572321 | 3300012212 | Avena Fatua Rhizosphere | DFTCFLQKFAANDPYANCDGSVIPPVLNVADFTCFLQSFAAGCP* |
Ga0150985_1197956012 | 3300012212 | Avena Fatua Rhizosphere | LDFSCFLAKFVAHDPYANCDGSTAAPTLNFADFSCFLTKFAAGCP* |
Ga0150985_1228207401 | 3300012212 | Avena Fatua Rhizosphere | CDSSTVAPILNVLDFNCFLNKFAASDCYANCDNSTTPPVLNVLDFNCFLNQFAAGCP* |
Ga0137449_11539012 | 3300012227 | Soil | STTPPILNVLDFGCFLNKFASSDSYANCDHSTTPPVLNVLDFGCFLNSFAAGCS* |
Ga0150984_1003332402 | 3300012469 | Avena Fatua Rhizosphere | VANVADFTCFLQKFASAHPYANCDASTTPPTINVADFTCFLQKFAAGCP* |
Ga0150984_1124105921 | 3300012469 | Avena Fatua Rhizosphere | NVADFSCFLVAFASRDAHANCDGSTAPPALNVADFTCFLQKFAAGCP* |
Ga0150984_1157982922 | 3300012469 | Avena Fatua Rhizosphere | VLDFNCFLNAFSSGQTYANCDNSTTPPVLNVLDFNCFLNKFSLGCSAP* |
Ga0150984_1193678561 | 3300012469 | Avena Fatua Rhizosphere | STTAPVLNVADFTCFLQRFAAAAPYANCDGSTQPPVLNVADFTCFLQRFAAGCP* |
Ga0150984_1197966052 | 3300012469 | Avena Fatua Rhizosphere | FAAGDSYANCDGSTIAPVLNVLDFNCFLNTFAAGCP* |
Ga0138256_105409611 | 3300012533 | Active Sludge | CDGSTGFPLATANDFQCFLNAYVSHQAYANCDRSSSPPTLTANDFQCFLDSYVSGCS* |
Ga0157294_101318591 | 3300012892 | Soil | NNRFAAGESYANCDASTIAPTLNVNDFTCFLNAYAAGCGR* |
Ga0157284_102205612 | 3300012893 | Soil | LNVNDFTCFLNLFAAGNTTANCDASTVPPILNVNDFTCFLNRFAVGCT* |
Ga0157288_103367861 | 3300012901 | Soil | FSCFLNRYAAGGTLANCDESTIAPVLNVNDFSCFLNRYAAGCP* |
Ga0157289_104168252 | 3300012903 | Soil | FSCFLNRFAAGECYANCDGSTAMPVLNVNDYSCFLNQYAVGCP* |
Ga0157301_104286051 | 3300012911 | Soil | NRYAAADAYANCDASTIAPVLNVNDFVCFTNKYAAGCP* |
Ga0157310_105495892 | 3300012916 | Soil | FICFNNYFAAGNAYANCDASTVAPVLNVNDFTCFLNKYAAGCP* |
Ga0137359_113980532 | 3300012923 | Vadose Zone Soil | LDFGCFLNKFAAGDTYANCDLSTTVPILNVLDFGCFLNKFAAGCSNC* |
Ga0137359_115013132 | 3300012923 | Vadose Zone Soil | PVLNANDFQCFLNAFAAGQSYANCDGSTVVPVLNANDFQCFLNAYAVGCS* |
Ga0137413_114097191 | 3300012924 | Vadose Zone Soil | PPVLNVLDFGCFLNKFAAGDPYANCDGSTTPPVLNVLDFGCFLNKFAAGCS* |
Ga0137404_118822782 | 3300012929 | Vadose Zone Soil | VLTANDFQCFLNAYASGATYANCDASTTTPVLTANDFQCFLNAFAAGCS* |
Ga0154020_100271478 | 3300012956 | Active Sludge | PTLTANDFQCFLNAYAAGDPYANCDRSTSTPMLTANDFQCFLNSYAVGCS* |
Ga0154020_100415641 | 3300012956 | Active Sludge | ANDFQCFLNAFAAGKNYANCDQSTASPLLTANDFQCFLIKYAQGCQ* |
Ga0154020_100573231 | 3300012956 | Active Sludge | LTANDFQCFLNKFSGGDPYANCDGSSTPPLLTANDFQCFLNAFAAGCP* |
Ga0154020_105992862 | 3300012956 | Active Sludge | PVLTANDFQCFLNKFAAADPTANCDGSTAVPTLTANDFQCFLNAYATGCI* |
Ga0154020_108128282 | 3300012956 | Active Sludge | CFNNRFAAGQSYANCDGSTTVPVLNVNDFICFNNRFAAGCP* |
Ga0154020_112449591 | 3300012956 | Active Sludge | NVLDFSCFLNEFAAGNSYANCDNSTNPPVLNVLDFSCFLNKFAAGCS* |
Ga0154020_112742291 | 3300012956 | Active Sludge | LNKFAAGDPAANCDQSTIPPVLNVNDFSCFLNKFAAGCP* |
Ga0154020_114393772 | 3300012956 | Active Sludge | NVNDFTCFLNRFAAGEPYANCDGSSIAPVLNVNDFVCFLNRYAEGCP* |
Ga0126369_106365072 | 3300012971 | Tropical Forest Soil | PILNANDFQCFLNKYAANDTYANCDGSTSPPTLNANDFQCFLNAYAAGCS* |
Ga0126369_123325902 | 3300012971 | Tropical Forest Soil | TVPYLNANDFTCFLNKFAAGDSYANCDGSTVPPVLTANDFACFLNQFAAGCSAP* |
Ga0126369_126067402 | 3300012971 | Tropical Forest Soil | DESTSPPILNINDFQCFLGKFAIGDPYANCDQSTTPPVLNINDFQCFVNKFASGCP* |
Ga0126369_128483431 | 3300012971 | Tropical Forest Soil | NDFQCFLNKFAAGDEYANCDGSTTPPILTAADFACFMNLYTAGCP* |
Ga0126369_128645152 | 3300012971 | Tropical Forest Soil | CFLNAYAAGQAYANCDGSTADPILNANDFQCFLNKYAAGCT* |
Ga0126369_128656191 | 3300012971 | Tropical Forest Soil | LNVNDFMCFMNKFSNGDPAANCDLSVNPPILNVNDFQCFLNKFAAQCP* |
Ga0126369_129458991 | 3300012971 | Tropical Forest Soil | NDFQCFLNKYAAGDSYANCDHSTVPPVLNANDFQCFLNAFAAGCT* |
Ga0126369_131574542 | 3300012971 | Tropical Forest Soil | NAGDTYANCDHSTTPPVLNVSDFSCFLNAFGSGCT* |
Ga0126369_135352101 | 3300012971 | Tropical Forest Soil | QARFAAGDSYANCDGSTTDPILTVNDFICFQGQFAAGCP* |
Ga0126369_136944432 | 3300012971 | Tropical Forest Soil | PVLNANDFQCFLNEFASGNPLANCDGSTTPPVLNANDFQCFLNQFAAGCS* |
Ga0157374_122519131 | 3300013296 | Miscanthus Rhizosphere | VNDFTCFINQYAAAATYANCDQSTIPPVLNVNDFTCFTTKYAAGCP* |
Ga0157374_122698261 | 3300013296 | Miscanthus Rhizosphere | NRFAAADPYANCDGSTAPPLLNVNDFIRFLNRFATGCP* |
Ga0157378_127336261 | 3300013297 | Miscanthus Rhizosphere | DFGCFLQKYAAGDPYANCDNSVAVPVLNVADFTCFLQKYATGCP* |
Ga0163162_121156862 | 3300013306 | Switchgrass Rhizosphere | CFLNKYAAQDPYANCDQSTTAPTLNVNDFTCFLNKYAAGCP* |
Ga0157375_113532042 | 3300013308 | Miscanthus Rhizosphere | NDFVCFQNLYAAGSAAANCDGSTTAPVLNVNDFICFQNLYAAGCP* |
Ga0157375_126203002 | 3300013308 | Miscanthus Rhizosphere | APVLNVADFGCFLQKYAAGDPYANCDNSVAVPVLNVADFTCFLQKYATGCP* |
Ga0157375_133962422 | 3300013308 | Miscanthus Rhizosphere | ANDPWANCDGSTSPPVLNVNDFICFNNLFAAGCANP* |
Ga0157375_136565072 | 3300013308 | Miscanthus Rhizosphere | DFICFLNRYAAKSPYANCDGSTAWPYLSVADFTCFTNRFAVGCP* |
Ga0119901_10373561 | 3300013502 | Activated Sludge | CFLNKFVPGHPYANCDGSTGTPTLTAGDYQCFLNKFAGGCS* |
Ga0119901_11431981 | 3300013502 | Activated Sludge | ANDFQCFLNKFAAGHPYANCDESTGTPMLTANDFMCFLSQSIAFCP* |
Ga0119901_12079631 | 3300013502 | Activated Sludge | NKFAAGDPGANCDGSTGTPLLTANDFQCFLNAYAVGCP* |
Ga0119901_12373441 | 3300013502 | Activated Sludge | GRPRTPALTANDFMCFLNKYPSADPAANCDNSTMQPMLNANDFACFINKYAAGCP* |
Ga0119901_12373571 | 3300013502 | Activated Sludge | LNAYARGDAAANCDGSTGAPTLTANDFQCFLNTFAAGCS* |
Ga0134079_103048041 | 3300014166 | Grasslands Soil | VADFTCFLQKFAALDPYANCDASTTVPALNVADFTCFLQRFATGCP* |
Ga0075355_10504932 | 3300014322 | Natural And Restored Wetlands | LNVLDFSCFLNKFAAGDTYANCDNSTTAPVLNVLDFSCFLNKFAAGCSGC* |
Ga0075355_10653512 | 3300014322 | Natural And Restored Wetlands | VLDFGCFLNRFAAGDTFANCDGSTTVPVLNVLDFGCFLNRFAAGCS* |
Ga0075355_10852051 | 3300014322 | Natural And Restored Wetlands | VNDFACFLNKFAAGDTFANCDGSTAPPVLNVLDFSCFLNAFAVGCT* |
Ga0163163_110567662 | 3300014325 | Switchgrass Rhizosphere | CFNNRFAAGDSYANCDQSTFPPVLNVNDFSCFMNKYAVGCP* |
Ga0163163_114328781 | 3300014325 | Switchgrass Rhizosphere | FICFNNRFAAGESYANCDASTIAPTLNVNDFTCFLNAYAAGCGR* |
Ga0163163_129556691 | 3300014325 | Switchgrass Rhizosphere | SYAAGQSYANCDQSTVPPVLNVNDFTCFMNRYAAGCP* |
Ga0157380_109464901 | 3300014326 | Switchgrass Rhizosphere | LNVNDFSCFLNKYAAGDAFANCDRSTIAPILNVNDFSCFLNKFAAGCP* |
Ga0157380_123732691 | 3300014326 | Switchgrass Rhizosphere | HNKFALGQSYANCDASTLPPLLNVNDYTCFLNAFAAGCL* |
Ga0157380_130780911 | 3300014326 | Switchgrass Rhizosphere | FSCFLNRYAAGDPWANCDGSTIPPILNVNDFSCFLNKYASGCS* |
Ga0157380_132446371 | 3300014326 | Switchgrass Rhizosphere | VCFNNRYQAGDTYANCDASTNVPVLNVNDFVCFNNKFAAGCR* |
Ga0120193_100474862 | 3300014965 | Terrestrial | DSYANCDGSTATPTLNVCDFTCFLQKYGAGWPWPP* |
Ga0157376_108500323 | 3300014969 | Miscanthus Rhizosphere | HDPDAYANCDNSTTVPVLNVADFTCFLQKCAAGCP* |
Ga0157376_114450982 | 3300014969 | Miscanthus Rhizosphere | LQRYAAGDLYANCDGSTTPPVLNVADFTCFLQRYAVGCP* |
Ga0157376_118387472 | 3300014969 | Miscanthus Rhizosphere | LNVADFTCFLQRYAANDPYANCDGSTVAPVLNVGDFTCFLQKYAAGCP* |
Ga0157376_122973611 | 3300014969 | Miscanthus Rhizosphere | PQLNVVDFTCFLQRFAAGDPYANCDASSASPALNALDFTCFLQKFANGCP* |
Ga0157376_125820742 | 3300014969 | Miscanthus Rhizosphere | VLNVADFTCFLQRYANNEAYANCDGSTVPPVLNVADFTCFLQAYANGCP* |
Ga0173480_104124531 | 3300015200 | Soil | TCFLNRYAASTPYANCDGSTAWPYLNVTDFVCFTNRYATGCP* |
Ga0173480_105511011 | 3300015200 | Soil | ASTSTPILNVNDFTCFLNKYAAADPYANCDASTAAPVLNVNDFTCFLNKFAAGCP* |
Ga0173480_107705702 | 3300015200 | Soil | FAAGDFSANCDSSTVAQVLNVNDYSCFLNAYAVGCP* |
Ga0173480_110060372 | 3300015200 | Soil | CDGSTAPPVLNIGDFVCFLNHFAAADPWANCDLSSAPPVLNANDFVCFLNQFASGCP* |
Ga0173480_112386831 | 3300015200 | Soil | FSNKFAAGDPTANCDGSTVAPVLNVNDFVCFSNKFASGCP* |
Ga0173478_102353651 | 3300015201 | Soil | NRFAGMNPYANCDGSTAIPTLNVADFICYLNRFAAGCE* |
Ga0173478_102983801 | 3300015201 | Soil | NNLFAAGDSYANCDASTIAPVLNVNDFSCFLNAYAVGCP* |
Ga0132258_126601193 | 3300015371 | Arabidopsis Rhizosphere | VQPALNVQDFGCFLNKFAAGDPYANCDASTVAPILNVQDFACFLNRFAAGCS* |
Ga0132258_127907161 | 3300015371 | Arabidopsis Rhizosphere | DFSCFLNAFAAGDTYANCDHSTTPPILNVQDFACYLNAFAAGCP* |
Ga0132256_1035630701 | 3300015372 | Arabidopsis Rhizosphere | LNVQDFGCFLNKFANGDSYANCDNSTIPPILNVQDFGCFLNKFANGCSNC* |
Ga0132255_1051102561 | 3300015374 | Arabidopsis Rhizosphere | NVNDFVCFGNLYAAGNSYANCDASTISPILNVNDFICFGNKFAAGCGANNCSPRP* |
Ga0132255_1053259802 | 3300015374 | Arabidopsis Rhizosphere | NGDPYANSDESTAPPVLNVQDFLCFLNLFAAGCSEC* |
Ga0182041_114650721 | 3300016294 | Soil | PPILNANDFQCFLNKFAAQDPTANCDGSTAPPVLNANDFQCFLNKFAVGCT |
Ga0182033_111770432 | 3300016319 | Soil | FQCFLNKFAAGDPYANCDGSTVPPVLNANDFQCYLNKYAAGCS |
Ga0182035_104962972 | 3300016341 | Soil | STQPPILNANDFQCFLNKFAAADSYANCDQSTQPPILNANDFQCFLNKYAAGCS |
Ga0182037_110045402 | 3300016404 | Soil | CFLNKYAAGDTYANCDGSTNPPILNANDFQCFLNKYAAGCS |
Ga0182039_118212591 | 3300016422 | Soil | VPPILTINDFQCFLNRFAAQDAWANCDGSTATPVLNVNDFQCILNA |
Ga0163161_119140531 | 3300017792 | Switchgrass Rhizosphere | ILNVADFSCFLQKYANGDPYANCDGSTTVPVLNVADFSCFLQKYSAGCP |
Ga0163161_120074151 | 3300017792 | Switchgrass Rhizosphere | LNVNDFTCFLNRFAAGEPYANCDASTIAPVLNVNDFTCFLNKYAAGCP |
Ga0187821_104843852 | 3300017936 | Freshwater Sediment | FMTRFAAGASYANCDGSTTAPILDVNDFLCFQQKFASGCF |
Ga0187777_114530971 | 3300017974 | Tropical Peatland | STTQPCLNVSDFGCFLNRFSAGDTWANCDGSTQPPVLNIADFGCFLNKFSAGCSSC |
Ga0066669_112249442 | 3300018482 | Grasslands Soil | YTTRETSPTPPVLNVTGFACFLNRFAIGDPYANCDGSTSTPGLNVNDFACFLNGFATGCP |
Ga0184647_12438062 | 3300019263 | Groundwater Sediment | FACFLNKFAAADPYANCDGSTTPPTLNVLDFACFLNKFAAGCP |
Ga0173481_101977092 | 3300019356 | Soil | TCFLNRYAAAYPYANCDGSTLSPILNVNDFTCFLNKFAAGCQ |
Ga0173479_105439041 | 3300019362 | Soil | LNVNDFSCFLNKYAAGDAFANCDRSTIAPILNVNDFSCFLNKFAAGCP |
Ga0196964_106270352 | 3300020202 | Soil | YAAGEPYANCDSSTTPPVLNVADFSCFLAAYAAGCP |
Ga0182009_105128451 | 3300021445 | Soil | ILNVLDFACFLNKFAAGDSYANCDGSTTAPILNVLDFACFLNRFAAGCS |
Ga0210392_111502891 | 3300021475 | Soil | CDASAAAPVLTANDFQCFLNAFASGSAYANCDHSTVVPVLSANDFQCFLNAFAEGCS |
Ga0210392_113539121 | 3300021475 | Soil | TANDFQCFLNKFATASCDANCDRSTSSPVLTANDFQCFLNKFAAGCS |
Ga0210392_114821171 | 3300021475 | Soil | FQCFLNKYATQDPSAYCDNSTNTPVLNVNDFQCFVNKFAAGCR |
Ga0179591_10509371 | 3300024347 | Vadose Zone Soil | CFLNRFAAGDSYANCDGSTTAPVLNVLDFSCFLNSFAAGCS |
Ga0207642_110198082 | 3300025899 | Miscanthus Rhizosphere | KFANGETYANCDGSTVPPVLNVQDFTCFLNAFAAGCT |
Ga0207699_102758202 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SSTAVPILNVQDFTCFLTRYASGDPYANCDSSTTIPVLNVQDFTCFLQRYATGCP |
Ga0207662_104479222 | 3300025918 | Switchgrass Rhizosphere | LPPVLNVNDFTCFANRFAAGDPYANCDLSTTPPVLNVNDFTCFLNQFAAGCP |
Ga0207694_113042101 | 3300025924 | Corn Rhizosphere | IADFTCFLQKFNAGDPWANCDASTTTPVLNILDYVCFMQKVAAGCP |
Ga0207650_102003521 | 3300025925 | Switchgrass Rhizosphere | VLNVGDFTCFLQKFASSNAYANCDGSTAAPVLNVADFTCFLQKFAAGCP |
Ga0207650_114787302 | 3300025925 | Switchgrass Rhizosphere | ILNVADFTCYLQHFAAGHAYANCDGSTAMPVLNVADFSCFLQRYANGCP |
Ga0207659_114596741 | 3300025926 | Miscanthus Rhizosphere | MAPVLGAPDFGCFLARFAAGDPYANCDGSTGTPLLNVADFTCFLQKFAAGCP |
Ga0207701_106590732 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | TCFLNKFGSGDTYANCDGSTTAPALNIADFACFLNRFNAGCS |
Ga0207701_109440491 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | PPILNISDFTCFLNRFAGMNPYANCDGSTAIPTLNVADFICYLNRFAAGCE |
Ga0207701_109862902 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | SDYICFLTRFAAADPYANCDNSTQPPTLNIADFICFQSRFISGCP |
Ga0207670_114760521 | 3300025936 | Switchgrass Rhizosphere | CFANRFAAGDPYANCDLSTTPPVLNVNDFTCFLNQFAAGCP |
Ga0207669_108285321 | 3300025937 | Miscanthus Rhizosphere | STTAPVANVADFTCFLQKFAASDPYANCDASTAPPVINVADFTCFLQKFAAGCP |
Ga0207704_116942681 | 3300025938 | Miscanthus Rhizosphere | LNGNDFQCFLNRYAEGNPYANCDSSATPPVLNVNDFQCFLNRYAAGCL |
Ga0207665_114190842 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RSTVTPVLNVNDFICFLNRLAAGDPYANCDHSTTPPVLNFFDFSCFLNKFVAGCS |
Ga0207691_107839021 | 3300025940 | Miscanthus Rhizosphere | STQIPFLNVQDFSCFLSKYASGNPYANCDGSTQVPTLNVQDFSCFLQKYASGCSAP |
Ga0207691_112509341 | 3300025940 | Miscanthus Rhizosphere | LLNVQDFTCFLSRFAAAEPYANCDGSTSAPMFNILDFNCFLQKFATGCP |
Ga0207711_107677761 | 3300025941 | Switchgrass Rhizosphere | APVLNVNDFTCFANKYAASDPYANCDGSTIAPVLNVNDFTCFLNQYAAGCP |
Ga0207711_111417952 | 3300025941 | Switchgrass Rhizosphere | PVLNVNDFICFLIAFASGDSYANCDASTTAPVLNVNDFICFQNLYAAGCP |
Ga0207689_112967643 | 3300025942 | Miscanthus Rhizosphere | CFLNAYAAGQSSANCDASTAPPVLNVSDFVCFLNAYAAACP |
Ga0207651_109965201 | 3300025960 | Switchgrass Rhizosphere | NKYAAGTPDANCDESTAAPVLNVNDFVCFLQKYAAGCP |
Ga0207651_113645822 | 3300025960 | Switchgrass Rhizosphere | FLGKYAAGDPYANCDGSSQAPVLNVGDFTCFLQKYAAGCPR |
Ga0207703_108224023 | 3300026035 | Switchgrass Rhizosphere | VLNVNDFVCYLNRYAAADPWANCDNSTAPPILNVNDFVCFLNKY |
Ga0207639_111236043 | 3300026041 | Corn Rhizosphere | TPVLNVNDFTCFLNRFAAGDAYANCDGSTTVPVLNVNDFTCFHDPGAAASSLTHSPLRRDAR |
Ga0208294_10138501 | 3300026057 | Natural And Restored Wetlands | PMLNVLDFSCFLNKFAAGDPYANCDNSTNPPVLNVLDFSCFLNKFAAGCSGC |
Ga0208294_10433192 | 3300026057 | Natural And Restored Wetlands | VLDFGCFLNRFAAGDTFANCDGSTTVPVLNVLDFGCFLNRFAAGCS |
Ga0207708_109953072 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | AFAPILNVGDFICFMNRFAAADPWANCDGSTIQPTLNVADFICFGNKFAAGCP |
Ga0207641_113462731 | 3300026088 | Switchgrass Rhizosphere | DFTCFLNRFAGMNPYANCDGSTAIPTLNVADFICYLNRFAAGCE |
Ga0207676_111648901 | 3300026095 | Switchgrass Rhizosphere | NSLNPPFLNVNDFICFNNAYAAGHPYCNCDGSTTPPVLNVNDFMCFTNMFAAGCSVP |
Ga0207676_121386552 | 3300026095 | Switchgrass Rhizosphere | VLNVNDFSCFLNSYAAGQTYANCDASTIAPVLNVNDFSCFLNRYAAGCT |
Ga0207675_1001479021 | 3300026118 | Switchgrass Rhizosphere | GSTEPPLLNFADFSCFLQKFAGGDAYANCDRSTAAPTLNVQDFTCFLQKFATGCP |
Ga0207675_1007162971 | 3300026118 | Switchgrass Rhizosphere | LAPLLTVNDFVCFLNRFSAGDPYANCDGSTAPPTLNVIDFMCFNNQFATGCQ |
Ga0207675_1007514931 | 3300026118 | Switchgrass Rhizosphere | VNDFTCFLNRFAAGEPYANCDGSTIPPVLNVNDFTCFLNKYAAGCP |
Ga0207675_1011848991 | 3300026118 | Switchgrass Rhizosphere | TINPTLNVNDFTCFLNKYAAGDAYANCDASTISPTLNVNDFTCFLNKYAAGCP |
Ga0207675_1017453373 | 3300026118 | Switchgrass Rhizosphere | LNKYAAGDAFANCDRSTIAPILNVNDFSCFLTKFAAGCP |
Ga0207675_1020833851 | 3300026118 | Switchgrass Rhizosphere | TPLLSSSDFICFLTQYAAGSIYANCDGSTAPPVLNVSDFLCFMSRVAAGCP |
Ga0207675_1021393241 | 3300026118 | Switchgrass Rhizosphere | LPPALNVNDFTCFLNQFAAGSQYANCDNSTLEPTLNVNDFSCFLNRFAASCP |
Ga0207675_1022783371 | 3300026118 | Switchgrass Rhizosphere | ICFNNRFAAGDSFANCDQSTIAPVLNVNDYICFNNLYATGCP |
Ga0207683_114401481 | 3300026121 | Miscanthus Rhizosphere | FSCFLAKYAAADATANCDASTAFTQLNVADFTCFLQKYAAGCSAP |
Ga0208685_11339552 | 3300027513 | Soil | TGTPVLTPNDFQCFLNAYAAASPSANCDGSTGTPTLTPNDFQCFLNAYAAGCS |
Ga0208454_11744731 | 3300027573 | Soil | APLLTANDFQCFLNKFAAGDPYANCDASTGNPALTANDFQCFINQFVSACP |
Ga0209683_105719041 | 3300027840 | Wetland Sediment | VLDFGCFLNAFAAGDTYANCDHSTTPPVLNVLDFGCFLNAFAAGCS |
Ga0209465_104129911 | 3300027874 | Tropical Forest Soil | TTPPVLNVADYACFLNRLFAGDTYANCDGSTTPPVLNVADFTCFLNAFAAACS |
Ga0209465_105384451 | 3300027874 | Tropical Forest Soil | CDNSTTPPILNISDFGCFLNRFAAGDTYANCDGSTTPPVLNVQDFSCFLNRFAAGCS |
Ga0209488_105175562 | 3300027903 | Vadose Zone Soil | ILNVSDFSCFLQRYADLDPYANCDGSTLPPTLNVTDFSCFLQQYANGCP |
Ga0209488_108659502 | 3300027903 | Vadose Zone Soil | QDFTCFLQKFAAADPYANCDASTAAPVLNVGDFTCFLQKFAAGCP |
Ga0209488_108884152 | 3300027903 | Vadose Zone Soil | TCFLQRFAAADPYANCDRSTAPPTLNVLDFPCYLQKFAAGCS |
Ga0247719_10590691 | 3300028041 | Soil | MPALNVADFPCFLQRFSSGDAYANCDGSRGQPVLNIADFSCFLQQFVAGCG |
Ga0247719_10605981 | 3300028041 | Soil | SCFLQKFAAGDPYANCDHSVQQPALNVADFACFLAKFAAMCAE |
Ga0247719_11257322 | 3300028041 | Soil | GSTTAPILNVADFSCFLSKFAAADPYANCDGSTTAPILNVADFSCFLSKFAAGCP |
Ga0247719_11659242 | 3300028041 | Soil | AAPALNVADFSCFLQKFAGGDPYANCDGSTAAPVLNVADFSCFLQRFAAGCP |
Ga0268265_107578633 | 3300028380 | Switchgrass Rhizosphere | SPPILNVNDFTCFLNAFAAGNTYANCDQSTAPPVLNVNDFTCFLNVFAAGCP |
Ga0268265_116234952 | 3300028380 | Switchgrass Rhizosphere | NRYAANDPYANCDGSTIAPVLNVNDFSCFLNKYAVGCP |
Ga0268264_109646882 | 3300028381 | Switchgrass Rhizosphere | NNHFALGDPMANCDGSTLPPVLNVSDFVCFLNRYAAGCP |
Ga0268264_110789012 | 3300028381 | Switchgrass Rhizosphere | TCFINAYAAQSSYANCDQSTNPPTLNVNDFFCFLNSYAIGCP |
Ga0268264_111767892 | 3300028381 | Switchgrass Rhizosphere | RFAAGDPYANCDMSTTPPTLNVNDFSCFLNRYAVGCP |
Ga0268264_124752192 | 3300028381 | Switchgrass Rhizosphere | DFTCFLNRYAAGESYANCDGSSGNPVLNVNDFICYLNVYAAGCS |
Ga0311333_117967502 | 3300030114 | Fen | ANDFQCFLNRYAAGDPYANCDGSSVPPILNANDFQCFLNAFAVGCS |
Ga0302323_1028033401 | 3300031232 | Fen | FTCFLNAFANGASYANCDGSTIVPVLTANDFQCFLNSFTMGCP |
Ga0302323_1030452451 | 3300031232 | Fen | NTNDFQCFLNRFAAGESYANCDGSTAPPVLNANDFQCFLNKFAAGCS |
Ga0302323_1032105391 | 3300031232 | Fen | CANCDGSSAPPVLNSLDFNCFINAFAAGSSAANCDGSTVEPVLTAGDFLCFLTAFAQGCK |
Ga0170820_117298182 | 3300031446 | Forest Soil | FLNVLDFTCFLQKFAAADPYANCDGSTQAPTLNVLDFTCFLQKFAAGCSAP |
Ga0310813_111551252 | 3300031716 | Soil | PPVLNVLDFSCFLNRFAAGDTYANCDHSTTPPVLNVLDFSCFLNNFAAGCT |
Ga0310813_117675842 | 3300031716 | Soil | AAGDSYANCDASTTPPVLNVSDFTCFLQKYAAGCP |
Ga0310813_121499992 | 3300031716 | Soil | LNKYASGDPYANCDGSTIPPVLNVNDFSCFLNKYAVGCQ |
Ga0306917_113800942 | 3300031719 | Soil | LNANDFQCFLNKFAAGDPYANCDGSTVPPVLNANDFQCYLNKYAAGCS |
Ga0307469_116605452 | 3300031720 | Hardwood Forest Soil | NDFNCFLSRFVAGESYANCDGSTSPPILNVNDFLCFIGRFAAGCD |
Ga0307468_1014434651 | 3300031740 | Hardwood Forest Soil | GSNTAPILNVADFTCFLQKFASGDCYANCDQSVTAPVLNVADFTCFLQSFAAGCP |
Ga0306919_107653552 | 3300031879 | Soil | VPPILTINDFQCFLNRFAAQDAWANCDGSTATPVLNVNDFQCILNAFAAGCS |
Ga0302322_1033338801 | 3300031902 | Fen | FLNKFAANDPYANCDGSTTLPILTANDFQCFLNKFAAGCP |
Ga0310900_118330992 | 3300031908 | Soil | KFAAGDPYANCDGSTTSPTLTVNDFVCFLIAYSGGCS |
Ga0306921_110819321 | 3300031912 | Soil | DFQCFINEFAAGGPRANCDGSTNPPILNANDFQCILNAYAAGCS |
Ga0306921_119609021 | 3300031912 | Soil | CFLNAFAAGSSYANCDNSTTPPVLNANDFQCFLNAFSAGCS |
Ga0306921_124302782 | 3300031912 | Soil | PILNANDFQCFLNKYAAADPYANCDHSTVDPVLNANDFQCFLNKFAVGCS |
Ga0310910_115120052 | 3300031946 | Soil | FAVSDPYANCDGSTVAPVLNANDFQCFLNKFAAGCS |
Ga0306926_117250601 | 3300031954 | Soil | FLNRFAAGDPYANCDGSTSPPVLNANDFQCFLNAFSQGCP |
Ga0306922_123346481 | 3300032001 | Soil | DFQCFLNNFAAGLSSANCDGSTVPPVLNANDFQCFLNAYAAGCS |
Ga0318562_108668462 | 3300032008 | Soil | FLNKFAAGDSDANCDASTVPPILNANDFQCFLNSYANGC |
Ga0310906_114185372 | 3300032013 | Soil | DYTCFLNHYAAGDSSANCDSSTTPPVLNVNDFTCFINSYAAGCS |
Ga0318559_104704441 | 3300032039 | Soil | KYAAGDSYANCDGSTAPPVINANDFQCFLNKYAAGCT |
Ga0318533_106597022 | 3300032059 | Soil | ANDFQCFLNKFAGGDTYANCDGSTAIPVLNANDFQCFLNKYAAGCS |
Ga0315912_106946561 | 3300032157 | Soil | DFACFLNRFAQGDSYANCDHSITSPVLSVNDLICYLNAFAAGCR |
Ga0306920_1011588261 | 3300032261 | Soil | FLCFLNRFAVGDPSANCDGSTAPPVLNVADFMCFQQKYIIGCP |
Ga0306920_1026095281 | 3300032261 | Soil | NINDFQCFLNKFASGDTYANCDASTTPPILNANDFSCFLNAFAAGCN |
Ga0306920_1043274662 | 3300032261 | Soil | ANDFQCFLNRYAAGDSYANCDGSTVAPTLNANDFQCYLNEYAAGCP |
Ga0335080_111841121 | 3300032828 | Soil | ILNINDFQCFINAFAAYDPYANCDGSTTDPILNVNDFQCFINKFAAGCS |
Ga0335080_112870841 | 3300032828 | Soil | CFINRFAAGDSYANCDGSTVAPVLNVNNFQCFLNTYAAGCS |
Ga0335080_119664081 | 3300032828 | Soil | CFLNKFAAGDTYANCDGSTANPILNANDFQCFLNKYAAGCP |
Ga0335080_120064221 | 3300032828 | Soil | CFLNRFAAGDSYANCDGSTVAPTLTANDFSCFLNSFAAGCS |
Ga0335080_123233981 | 3300032828 | Soil | LNKFAAGDPYANCDGSSTPPLLNANDFQCFLNAYAGGCP |
Ga0335070_108440142 | 3300032829 | Soil | CLNVLDFVCFLNKFAAADPLANCDGSTNPPVLNVLDFVCFLNQFAAGCSSC |
Ga0335070_108575811 | 3300032829 | Soil | NVLDFGCFLNRFAAGDTTANCDHSTSSPVLNVLDFGCFLNAFAAGCSGC |
Ga0335076_106258642 | 3300032955 | Soil | APILTANDFQCFLNKFAQGDTYANCDGSTAPPVLNANDFQCFLNAFAVGCS |
Ga0335076_111480482 | 3300032955 | Soil | PILNANDFQCFINTFAAADTSANCDGSTAPPVLNANDFQCFLNAFAAGCR |
Ga0335076_113841581 | 3300032955 | Soil | FLYKYASADPYANCDGSTATPILNANDFQCFLNAFAAGCT |
Ga0335077_115514922 | 3300033158 | Soil | NANDFQCFLNKFATGDTYANCDHSTAPPVLNANDFQCFLNAFAAGCS |
Ga0316621_101983491 | 3300033488 | Soil | SCFINKYAAADPYANCDGSTTAPVLNVNDFSCFLNKYAAGCP |
Ga0370499_0195629_384_536 | 3300034194 | Untreated Peat Soil | MLSANDFLCYLNRFADQDAAANCDGSTGEPVLTANDFSCFLNAYASGCGR |
⦗Top⦘ |