NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F004332

Metagenome / Metatranscriptome Family F004332

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F004332
Family Type Metagenome / Metatranscriptome
Number of Sequences 443
Average Sequence Length 45 residues
Representative Sequence GTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Number of Associated Samples 299
Number of Associated Scaffolds 443

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.23 %
% of genes near scaffold ends (potentially truncated) 99.55 %
% of genes from short scaffolds (< 2000 bps) 92.78 %
Associated GOLD sequencing projects 280
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.585 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(27.540 % of family members)
Environment Ontology (ENVO) Unclassified
(30.700 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.826 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.32%    β-sheet: 0.00%    Coil/Unstructured: 50.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 443 Family Scaffolds
PF01575MaoC_dehydratas 3.16
PF04679DNA_ligase_A_C 2.71
PF11139SfLAP 2.48
PF04224DUF417 2.03
PF12697Abhydrolase_6 1.58
PF07883Cupin_2 1.58
PF00196GerE 1.35
PF00144Beta-lactamase 1.35
PF08670MEKHLA 1.35
PF00248Aldo_ket_red 1.35
PF13271DUF4062 1.13
PF03537Glyco_hydro_114 1.13
PF13378MR_MLE_C 1.13
PF07859Abhydrolase_3 1.13
PF00905Transpeptidase 1.13
PF13191AAA_16 0.90
PF00730HhH-GPD 0.90
PF01565FAD_binding_4 0.90
PF07690MFS_1 0.90
PF13419HAD_2 0.90
PF13602ADH_zinc_N_2 0.68
PF02979NHase_alpha 0.68
PF00004AAA 0.68
PF08241Methyltransf_11 0.68
PF00561Abhydrolase_1 0.68
PF00027cNMP_binding 0.68
PF12270Cyt_c_ox_IV 0.68
PF07992Pyr_redox_2 0.68
PF01243Putative_PNPOx 0.68
PF01609DDE_Tnp_1 0.68
PF13581HATPase_c_2 0.68
PF13561adh_short_C2 0.45
PF01979Amidohydro_1 0.45
PF01636APH 0.45
PF00005ABC_tran 0.45
PF05988DUF899 0.45
PF01370Epimerase 0.45
PF01425Amidase 0.45
PF00406ADK 0.45
PF00881Nitroreductase 0.45
PF00941FAD_binding_5 0.45
PF00583Acetyltransf_1 0.45
PF00440TetR_N 0.45
PF01738DLH 0.45
PF08031BBE 0.45
PF11716MDMPI_N 0.45
PF00106adh_short 0.45
PF14863Alkyl_sulf_dimr 0.45
PF02627CMD 0.23
PF06224HTH_42 0.23
PF03795YCII 0.23
PF03551PadR 0.23
PF01596Methyltransf_3 0.23
PF05173DapB_C 0.23
PF02371Transposase_20 0.23
PF00392GntR 0.23
PF06912DUF1275 0.23
PF03706LPG_synthase_TM 0.23
PF02133Transp_cyt_pur 0.23
PF03704BTAD 0.23
PF04198Sugar-bind 0.23
PF01872RibD_C 0.23
PF01625PMSR 0.23
PF00291PALP 0.23
PF01068DNA_ligase_A_M 0.23
PF02577BFN_dom 0.23
PF01152Bac_globin 0.23
PF13847Methyltransf_31 0.23
PF13474SnoaL_3 0.23
PF04542Sigma70_r2 0.23
PF03176MMPL 0.23
PF00115COX1 0.23
PF13460NAD_binding_10 0.23
PF02776TPP_enzyme_N 0.23
PF14534DUF4440 0.23
PF13230GATase_4 0.23
PF00384Molybdopterin 0.23
PF15420Abhydrolase_9_N 0.23
PF00141peroxidase 0.23
PF00072Response_reg 0.23
PF06736TMEM175 0.23
PF04820Trp_halogenase 0.23
PF05199GMC_oxred_C 0.23
PF12146Hydrolase_4 0.23
PF10081Abhydrolase_9 0.23
PF07929PRiA4_ORF3 0.23
PF00355Rieske 0.23
PF08338DUF1731 0.23
PF01726LexA_DNA_bind 0.23
PF13424TPR_12 0.23
PF08044DUF1707 0.23
PF13480Acetyltransf_6 0.23
PF01263Aldose_epim 0.23
PF00033Cytochrome_B 0.23
PF03649UPF0014 0.23
PF00665rve 0.23
PF05496RuvB_N 0.23
PF00266Aminotran_5 0.23
PF00589Phage_integrase 0.23
PF04978DUF664 0.23
PF01238PMI_typeI_C 0.23
PF02517Rce1-like 0.23
PF03466LysR_substrate 0.23

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 443 Family Scaffolds
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 2.93
COG3059Reactive chlorine resistance protein RclC/YkgB, DUF417 familyDefense mechanisms [V] 2.03
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.35
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.35
COG2367Beta-lactamase class ADefense mechanisms [V] 1.35
COG3868Alpha-1,4 polygalactosaminidase, glycosyl hydrolase family GH114Carbohydrate transport and metabolism [G] 1.13
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 1.13
COG2342Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase)Carbohydrate transport and metabolism [G] 1.13
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.90
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.90
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.90
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.90
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.90
COG5421TransposaseMobilome: prophages, transposons [X] 0.68
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.68
COG3293TransposaseMobilome: prophages, transposons [X] 0.68
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.68
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.68
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.68
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.45
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.45
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.45
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 0.45
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.23
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.23
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.23
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.23
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.23
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.23
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.23
COG0390ABC-type iron transport system FetAB, permease componentInorganic ion transport and metabolism [P] 0.23
COG3547TransposaseMobilome: prophages, transposons [X] 0.23
COG3548Uncharacterized membrane proteinFunction unknown [S] 0.23
COG3619Uncharacterized membrane protein YoaK, UPF0700 familyFunction unknown [S] 0.23
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.23
COG0376Catalase (peroxidase I)Inorganic ion transport and metabolism [P] 0.23
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.23
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.23
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.23
COG02894-hydroxy-tetrahydrodipicolinate reductaseAmino acid transport and metabolism [E] 0.23
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.23
COG4584TransposaseMobilome: prophages, transposons [X] 0.23
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.23
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.23
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 0.23
COG2017Galactose mutarotase or related enzymeCarbohydrate transport and metabolism [G] 0.23
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 0.23
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.23
COG1482Mannose-6-phosphate isomerase, class ICarbohydrate transport and metabolism [G] 0.23
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.23
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 0.23
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.23
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.23
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.23
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 0.23
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.23
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.23
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.23
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.23
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.23
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 0.23
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.23
COG0676D-hexose-6-phosphate mutarotaseCarbohydrate transport and metabolism [G] 0.23
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.23
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.23
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.23
COG2390DNA-binding transcriptional regulator LsrR, DeoR familyTranscription [K] 0.23
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.23


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.58 %
UnclassifiedrootN/A12.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000787|JGI11643J11755_11574357All Organisms → cellular organisms → Bacteria → Terrabacteria group621Open in IMG/M
3300000956|JGI10216J12902_122947763Not Available639Open in IMG/M
3300001867|JGI12627J18819_10066309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1502Open in IMG/M
3300002245|JGIcombinedJ26739_101405980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300002568|C688J35102_118624654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300002568|C688J35102_119744315Not Available763Open in IMG/M
3300002568|C688J35102_120796401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1606Open in IMG/M
3300003505|JGIcombinedJ51221_10350906All Organisms → cellular organisms → Bacteria → Terrabacteria group600Open in IMG/M
3300004800|Ga0058861_11855068Not Available639Open in IMG/M
3300005093|Ga0062594_102940467All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005181|Ga0066678_10638964All Organisms → cellular organisms → Bacteria → Terrabacteria group709Open in IMG/M
3300005327|Ga0070658_10466050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1089Open in IMG/M
3300005332|Ga0066388_102139541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1008Open in IMG/M
3300005338|Ga0068868_101315629All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005341|Ga0070691_10053004All Organisms → cellular organisms → Bacteria → Terrabacteria group1940Open in IMG/M
3300005435|Ga0070714_101065135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium788Open in IMG/M
3300005435|Ga0070714_101479886Not Available663Open in IMG/M
3300005437|Ga0070710_10138822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1488Open in IMG/M
3300005437|Ga0070710_10969814All Organisms → cellular organisms → Bacteria → Terrabacteria group618Open in IMG/M
3300005437|Ga0070710_11067314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300005441|Ga0070700_101360336All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300005444|Ga0070694_101645439All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005467|Ga0070706_100047868All Organisms → cellular organisms → Bacteria3946Open in IMG/M
3300005467|Ga0070706_100969437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae784Open in IMG/M
3300005467|Ga0070706_101897937All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300005468|Ga0070707_100781537All Organisms → cellular organisms → Bacteria → Terrabacteria group918Open in IMG/M
3300005468|Ga0070707_100869929All Organisms → cellular organisms → Bacteria → Terrabacteria group866Open in IMG/M
3300005468|Ga0070707_101273787All Organisms → cellular organisms → Bacteria → Terrabacteria group701Open in IMG/M
3300005468|Ga0070707_101751345All Organisms → cellular organisms → Bacteria → Terrabacteria group588Open in IMG/M
3300005471|Ga0070698_100218732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1839Open in IMG/M
3300005471|Ga0070698_101458087All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300005536|Ga0070697_100706378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales890Open in IMG/M
3300005542|Ga0070732_10808599All Organisms → cellular organisms → Bacteria → Terrabacteria group572Open in IMG/M
3300005545|Ga0070695_100584185All Organisms → cellular organisms → Bacteria → Terrabacteria group875Open in IMG/M
3300005548|Ga0070665_100263206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1726Open in IMG/M
3300005549|Ga0070704_102271817All Organisms → cellular organisms → Bacteria → Terrabacteria group505Open in IMG/M
3300005559|Ga0066700_10328420All Organisms → cellular organisms → Bacteria → Terrabacteria group1080Open in IMG/M
3300005563|Ga0068855_100656315Not Available1126Open in IMG/M
3300005764|Ga0066903_100119435All Organisms → cellular organisms → Bacteria3656Open in IMG/M
3300005764|Ga0066903_100634354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1863Open in IMG/M
3300005764|Ga0066903_108044507Not Available541Open in IMG/M
3300005842|Ga0068858_101053952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae797Open in IMG/M
3300006028|Ga0070717_10607272All Organisms → cellular organisms → Bacteria → Terrabacteria group992Open in IMG/M
3300006028|Ga0070717_10743753All Organisms → cellular organisms → Bacteria → Terrabacteria group891Open in IMG/M
3300006050|Ga0075028_100287546All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300006059|Ga0075017_100948546All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300006173|Ga0070716_100531907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia873Open in IMG/M
3300006175|Ga0070712_100679544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria876Open in IMG/M
3300006581|Ga0074048_13465876All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300006605|Ga0074057_10043859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia689Open in IMG/M
3300006755|Ga0079222_11486152All Organisms → cellular organisms → Bacteria → Terrabacteria group634Open in IMG/M
3300006800|Ga0066660_11230402All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300006804|Ga0079221_10812046All Organisms → cellular organisms → Bacteria → Terrabacteria group672Open in IMG/M
3300006806|Ga0079220_10155629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1267Open in IMG/M
3300006806|Ga0079220_10326890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria962Open in IMG/M
3300006893|Ga0073928_10223207All Organisms → cellular organisms → Bacteria → Terrabacteria group1459Open in IMG/M
3300006903|Ga0075426_10779755All Organisms → cellular organisms → Bacteria → Terrabacteria group719Open in IMG/M
3300006954|Ga0079219_11262834All Organisms → cellular organisms → Bacteria → Terrabacteria group646Open in IMG/M
3300006954|Ga0079219_12296406Not Available521Open in IMG/M
3300006954|Ga0079219_12349321All Organisms → cellular organisms → Bacteria → Terrabacteria group516Open in IMG/M
3300009038|Ga0099829_11524030All Organisms → cellular organisms → Bacteria → Terrabacteria group552Open in IMG/M
3300009090|Ga0099827_10012738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5524Open in IMG/M
3300009090|Ga0099827_10108208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2221Open in IMG/M
3300009093|Ga0105240_11249358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia785Open in IMG/M
3300009093|Ga0105240_12465467All Organisms → cellular organisms → Bacteria → Terrabacteria group538Open in IMG/M
3300009094|Ga0111539_12392908All Organisms → cellular organisms → Bacteria → Terrabacteria group613Open in IMG/M
3300009098|Ga0105245_10706505All Organisms → cellular organisms → Bacteria → Terrabacteria group1042Open in IMG/M
3300009137|Ga0066709_101031322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1206Open in IMG/M
3300009137|Ga0066709_103430541Not Available575Open in IMG/M
3300009137|Ga0066709_104249298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium522Open in IMG/M
3300009147|Ga0114129_12768687All Organisms → cellular organisms → Bacteria → Terrabacteria group583Open in IMG/M
3300009147|Ga0114129_12789944All Organisms → cellular organisms → Bacteria → Terrabacteria group581Open in IMG/M
3300009174|Ga0105241_10970508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.793Open in IMG/M
3300009176|Ga0105242_11245046All Organisms → cellular organisms → Bacteria → Terrabacteria group765Open in IMG/M
3300009545|Ga0105237_10971203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae856Open in IMG/M
3300009553|Ga0105249_10559432All Organisms → cellular organisms → Bacteria → Terrabacteria group1195Open in IMG/M
3300009698|Ga0116216_10430708All Organisms → cellular organisms → Bacteria → Terrabacteria group799Open in IMG/M
3300009792|Ga0126374_10286685All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300009826|Ga0123355_11357021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300010040|Ga0126308_10227480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. DSM 1104861206Open in IMG/M
3300010043|Ga0126380_10500616Not Available932Open in IMG/M
3300010045|Ga0126311_10050183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2678Open in IMG/M
3300010046|Ga0126384_10577767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia980Open in IMG/M
3300010048|Ga0126373_10966801All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300010048|Ga0126373_11054427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia879Open in IMG/M
3300010048|Ga0126373_12434829All Organisms → cellular organisms → Bacteria → Terrabacteria group583Open in IMG/M
3300010048|Ga0126373_12737361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia550Open in IMG/M
3300010145|Ga0126321_1425696All Organisms → cellular organisms → Bacteria → Terrabacteria group1103Open in IMG/M
3300010154|Ga0127503_10003929All Organisms → cellular organisms → Bacteria → Terrabacteria group1013Open in IMG/M
3300010154|Ga0127503_11113423All Organisms → cellular organisms → Bacteria → Terrabacteria group685Open in IMG/M
3300010358|Ga0126370_10855066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia817Open in IMG/M
3300010358|Ga0126370_12298163All Organisms → cellular organisms → Bacteria → Terrabacteria group533Open in IMG/M
3300010359|Ga0126376_10557215All Organisms → cellular organisms → Bacteria → Terrabacteria group1074Open in IMG/M
3300010360|Ga0126372_12692321All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300010361|Ga0126378_10034317Not Available4578Open in IMG/M
3300010361|Ga0126378_10363274All Organisms → cellular organisms → Bacteria → Terrabacteria group1558Open in IMG/M
3300010362|Ga0126377_10544216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1199Open in IMG/M
3300010366|Ga0126379_11789634All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300010366|Ga0126379_12720501All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300010366|Ga0126379_13143224All Organisms → cellular organisms → Bacteria → Terrabacteria group553Open in IMG/M
3300010373|Ga0134128_10116337All Organisms → cellular organisms → Bacteria3034Open in IMG/M
3300010376|Ga0126381_101171881All Organisms → cellular organisms → Bacteria → Terrabacteria group1110Open in IMG/M
3300010376|Ga0126381_101648544All Organisms → cellular organisms → Bacteria → Terrabacteria group926Open in IMG/M
3300010376|Ga0126381_101684490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus916Open in IMG/M
3300010376|Ga0126381_101888731All Organisms → cellular organisms → Bacteria → Terrabacteria group861Open in IMG/M
3300010376|Ga0126381_104740660All Organisms → cellular organisms → Bacteria → Terrabacteria group523Open in IMG/M
3300010379|Ga0136449_103096177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia646Open in IMG/M
3300010379|Ga0136449_104368157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300010396|Ga0134126_11701719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia692Open in IMG/M
3300010396|Ga0134126_12563905All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300010398|Ga0126383_12276819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa628Open in IMG/M
3300010401|Ga0134121_12869416All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300010867|Ga0126347_1361780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria817Open in IMG/M
3300010867|Ga0126347_1555046All Organisms → cellular organisms → Bacteria → Terrabacteria group746Open in IMG/M
3300010880|Ga0126350_10287626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1757Open in IMG/M
3300011000|Ga0138513_100044040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria670Open in IMG/M
3300011107|Ga0151490_1737555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales507Open in IMG/M
3300011332|Ga0126317_10810259Not Available1705Open in IMG/M
3300012199|Ga0137383_10283933All Organisms → cellular organisms → Bacteria → Terrabacteria group1212Open in IMG/M
3300012199|Ga0137383_11114317All Organisms → cellular organisms → Bacteria → Terrabacteria group571Open in IMG/M
3300012200|Ga0137382_10898262All Organisms → cellular organisms → Bacteria → Terrabacteria group638Open in IMG/M
3300012200|Ga0137382_11238650All Organisms → cellular organisms → Bacteria → Terrabacteria group529Open in IMG/M
3300012204|Ga0137374_10812381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia693Open in IMG/M
3300012209|Ga0137379_11359814All Organisms → cellular organisms → Bacteria → Terrabacteria group614Open in IMG/M
3300012211|Ga0137377_10749365All Organisms → cellular organisms → Bacteria → Terrabacteria group910Open in IMG/M
3300012212|Ga0150985_105062470All Organisms → cellular organisms → Bacteria → Terrabacteria group619Open in IMG/M
3300012212|Ga0150985_105831586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia902Open in IMG/M
3300012212|Ga0150985_114521061All Organisms → cellular organisms → Bacteria → Terrabacteria group538Open in IMG/M
3300012349|Ga0137387_10802180All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300012354|Ga0137366_10449715All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300012354|Ga0137366_10833845All Organisms → cellular organisms → Bacteria → Terrabacteria group654Open in IMG/M
3300012357|Ga0137384_10144000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1995Open in IMG/M
3300012358|Ga0137368_10403737All Organisms → cellular organisms → Bacteria → Terrabacteria group897Open in IMG/M
3300012359|Ga0137385_11326794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. TRM90224582Open in IMG/M
3300012360|Ga0137375_10515742All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300012361|Ga0137360_10911031All Organisms → cellular organisms → Bacteria → Terrabacteria group758Open in IMG/M
3300012363|Ga0137390_10018341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6423Open in IMG/M
3300012363|Ga0137390_10188971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae2046Open in IMG/M
3300012363|Ga0137390_11508412All Organisms → cellular organisms → Bacteria → Terrabacteria group613Open in IMG/M
3300012469|Ga0150984_105507322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia750Open in IMG/M
3300012896|Ga0157303_10040337All Organisms → cellular organisms → Bacteria → Terrabacteria group909Open in IMG/M
3300012917|Ga0137395_10453906Not Available921Open in IMG/M
3300012930|Ga0137407_10765815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria911Open in IMG/M
3300012930|Ga0137407_10773969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300012957|Ga0164303_11541953All Organisms → cellular organisms → Bacteria → Terrabacteria group504Open in IMG/M
3300012961|Ga0164302_10231219All Organisms → cellular organisms → Bacteria → Terrabacteria group1161Open in IMG/M
3300012971|Ga0126369_10782967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1035Open in IMG/M
3300012971|Ga0126369_11779052All Organisms → cellular organisms → Bacteria → Terrabacteria group705Open in IMG/M
3300012971|Ga0126369_12054723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300012971|Ga0126369_12467568All Organisms → cellular organisms → Bacteria → Terrabacteria group605Open in IMG/M
3300012971|Ga0126369_13310199All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300013045|Ga0154016_141449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia984Open in IMG/M
3300013104|Ga0157370_11942424All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300013296|Ga0157374_10278881All Organisms → cellular organisms → Bacteria → Terrabacteria group1650Open in IMG/M
3300013306|Ga0163162_10744963All Organisms → cellular organisms → Bacteria → Terrabacteria group1099Open in IMG/M
3300013306|Ga0163162_11236877All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300014157|Ga0134078_10454474All Organisms → cellular organisms → Bacteria → Terrabacteria group586Open in IMG/M
3300014166|Ga0134079_10461148Not Available605Open in IMG/M
3300014166|Ga0134079_10652883All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300015359|Ga0134085_10500434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300015371|Ga0132258_11182811Not Available1933Open in IMG/M
3300015371|Ga0132258_13684037All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1046Open in IMG/M
3300016294|Ga0182041_12084100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300016319|Ga0182033_10370521Not Available1203Open in IMG/M
3300016319|Ga0182033_10905888All Organisms → cellular organisms → Bacteria → Terrabacteria group781Open in IMG/M
3300016319|Ga0182033_11631013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia584Open in IMG/M
3300016319|Ga0182033_12096837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300016357|Ga0182032_10273910Not Available1322Open in IMG/M
3300016371|Ga0182034_10801719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_235806Open in IMG/M
3300016387|Ga0182040_10839175All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300016404|Ga0182037_10746460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium841Open in IMG/M
3300016422|Ga0182039_10243353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1461Open in IMG/M
3300016445|Ga0182038_11145872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae692Open in IMG/M
3300016445|Ga0182038_11272736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300016445|Ga0182038_11652908All Organisms → cellular organisms → Bacteria → Terrabacteria group577Open in IMG/M
3300017657|Ga0134074_1341715Not Available551Open in IMG/M
3300017924|Ga0187820_1181811All Organisms → cellular organisms → Bacteria → Terrabacteria group648Open in IMG/M
3300017926|Ga0187807_1079208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1026Open in IMG/M
3300017928|Ga0187806_1090918All Organisms → cellular organisms → Bacteria → Terrabacteria group966Open in IMG/M
3300017937|Ga0187809_10231092All Organisms → cellular organisms → Bacteria → Terrabacteria group664Open in IMG/M
3300017942|Ga0187808_10086975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1351Open in IMG/M
3300017942|Ga0187808_10303004All Organisms → cellular organisms → Bacteria → Terrabacteria group720Open in IMG/M
3300017942|Ga0187808_10469962All Organisms → cellular organisms → Bacteria → Terrabacteria group580Open in IMG/M
3300017973|Ga0187780_10005791All Organisms → cellular organisms → Bacteria9220Open in IMG/M
3300017974|Ga0187777_10414730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia933Open in IMG/M
3300017974|Ga0187777_11347708All Organisms → cellular organisms → Bacteria → Terrabacteria group525Open in IMG/M
3300017997|Ga0184610_1314099All Organisms → cellular organisms → Bacteria → Terrabacteria group515Open in IMG/M
3300018054|Ga0184621_10104840All Organisms → cellular organisms → Bacteria → Terrabacteria group1003Open in IMG/M
3300018054|Ga0184621_10183396All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300018058|Ga0187766_10008509All Organisms → cellular organisms → Bacteria5907Open in IMG/M
3300018058|Ga0187766_11431677All Organisms → cellular organisms → Bacteria → Terrabacteria group508Open in IMG/M
3300018060|Ga0187765_10447460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella807Open in IMG/M
3300018061|Ga0184619_10148074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1071Open in IMG/M
3300018076|Ga0184609_10250462All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300018081|Ga0184625_10471628All Organisms → cellular organisms → Bacteria → Terrabacteria group640Open in IMG/M
3300018081|Ga0184625_10606297All Organisms → cellular organisms → Bacteria → Terrabacteria group536Open in IMG/M
3300018089|Ga0187774_11097253All Organisms → cellular organisms → Bacteria → Terrabacteria group563Open in IMG/M
3300018429|Ga0190272_12719881All Organisms → cellular organisms → Bacteria → Terrabacteria group544Open in IMG/M
3300018432|Ga0190275_11458890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia761Open in IMG/M
3300018433|Ga0066667_11024881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium712Open in IMG/M
3300018920|Ga0190273_10135107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1446Open in IMG/M
3300019356|Ga0173481_10254296Not Available793Open in IMG/M
3300019867|Ga0193704_1008424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2060Open in IMG/M
3300020020|Ga0193738_1100402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia827Open in IMG/M
3300020070|Ga0206356_10778600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa642Open in IMG/M
3300020070|Ga0206356_11067460All Organisms → cellular organisms → Bacteria → Terrabacteria group574Open in IMG/M
3300020081|Ga0206354_10066115All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300020082|Ga0206353_10879077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria893Open in IMG/M
3300020580|Ga0210403_10749921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae779Open in IMG/M
3300020581|Ga0210399_10173511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1788Open in IMG/M
3300020581|Ga0210399_11134526All Organisms → cellular organisms → Bacteria → Terrabacteria group624Open in IMG/M
3300020581|Ga0210399_11353818All Organisms → cellular organisms → Bacteria → Terrabacteria group558Open in IMG/M
3300020583|Ga0210401_10453313All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300021078|Ga0210381_10033564All Organisms → cellular organisms → Bacteria → Terrabacteria group1458Open in IMG/M
3300021178|Ga0210408_10912912All Organisms → cellular organisms → Bacteria → Terrabacteria group683Open in IMG/M
3300021402|Ga0210385_10878358All Organisms → cellular organisms → Bacteria → Terrabacteria group688Open in IMG/M
3300021404|Ga0210389_10339886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1178Open in IMG/M
3300021407|Ga0210383_11121518All Organisms → cellular organisms → Bacteria → Terrabacteria group663Open in IMG/M
3300021477|Ga0210398_10092719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2452Open in IMG/M
3300021478|Ga0210402_10110405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2478Open in IMG/M
3300021478|Ga0210402_10476303All Organisms → cellular organisms → Bacteria → Terrabacteria group1159Open in IMG/M
3300021559|Ga0210409_10527598All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300021559|Ga0210409_10999184Not Available711Open in IMG/M
3300022467|Ga0224712_10052462All Organisms → cellular organisms → Bacteria → Terrabacteria group1593Open in IMG/M
3300022756|Ga0222622_10156129Not Available1476Open in IMG/M
3300022756|Ga0222622_11148744All Organisms → cellular organisms → Bacteria → Terrabacteria group571Open in IMG/M
3300022901|Ga0247788_1072560All Organisms → cellular organisms → Bacteria → Terrabacteria group658Open in IMG/M
3300024325|Ga0247678_1071182All Organisms → cellular organisms → Bacteria → Terrabacteria group576Open in IMG/M
3300025910|Ga0207684_10776712All Organisms → cellular organisms → Bacteria → Terrabacteria group811Open in IMG/M
3300025910|Ga0207684_10928692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales730Open in IMG/M
3300025910|Ga0207684_11539791All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300025914|Ga0207671_10851128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria722Open in IMG/M
3300025915|Ga0207693_10647997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia821Open in IMG/M
3300025916|Ga0207663_10629584All Organisms → cellular organisms → Bacteria → Terrabacteria group845Open in IMG/M
3300025916|Ga0207663_11738135All Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300025921|Ga0207652_10351627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Iso8991330Open in IMG/M
3300025921|Ga0207652_10453414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1156Open in IMG/M
3300025921|Ga0207652_11646538Not Available546Open in IMG/M
3300025922|Ga0207646_10652688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium942Open in IMG/M
3300025922|Ga0207646_10824963All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300025923|Ga0207681_11024624Not Available693Open in IMG/M
3300025927|Ga0207687_10170392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1679Open in IMG/M
3300025933|Ga0207706_11079120Not Available672Open in IMG/M
3300025939|Ga0207665_10326399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1153Open in IMG/M
3300025939|Ga0207665_10983607All Organisms → cellular organisms → Bacteria → Terrabacteria group671Open in IMG/M
3300025941|Ga0207711_10548580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1078Open in IMG/M
3300025942|Ga0207689_10800266Not Available796Open in IMG/M
3300025944|Ga0207661_11901612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300025949|Ga0207667_10394254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1410Open in IMG/M
3300025961|Ga0207712_11190525Not Available680Open in IMG/M
3300025981|Ga0207640_11467150Not Available612Open in IMG/M
3300026023|Ga0207677_10396049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1170Open in IMG/M
3300026067|Ga0207678_10890167All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300026078|Ga0207702_11810725All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300026089|Ga0207648_10797256Not Available879Open in IMG/M
3300026551|Ga0209648_10638883All Organisms → cellular organisms → Bacteria → Terrabacteria group583Open in IMG/M
3300027117|Ga0209732_1087995Not Available541Open in IMG/M
3300027528|Ga0208985_1041805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria893Open in IMG/M
3300027725|Ga0209178_1220148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia678Open in IMG/M
3300027727|Ga0209328_10156806All Organisms → cellular organisms → Bacteria → Terrabacteria group691Open in IMG/M
3300027855|Ga0209693_10216353All Organisms → cellular organisms → Bacteria → Terrabacteria group942Open in IMG/M
3300027875|Ga0209283_10090824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus carbonis1989Open in IMG/M
3300027882|Ga0209590_10039154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2569Open in IMG/M
3300027903|Ga0209488_10064305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2713Open in IMG/M
3300027908|Ga0209006_10105463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2497Open in IMG/M
3300028047|Ga0209526_10781877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300028072|Ga0247675_1016223All Organisms → cellular organisms → Bacteria → Terrabacteria group1061Open in IMG/M
3300028380|Ga0268265_12065880All Organisms → cellular organisms → Bacteria → Terrabacteria group577Open in IMG/M
3300028536|Ga0137415_10185583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1904Open in IMG/M
3300028587|Ga0247828_10845536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia584Open in IMG/M
3300028596|Ga0247821_10168700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1278Open in IMG/M
3300028597|Ga0247820_10396252All Organisms → cellular organisms → Bacteria → Terrabacteria group923Open in IMG/M
3300028717|Ga0307298_10001617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5205Open in IMG/M
3300028722|Ga0307319_10297865All Organisms → cellular organisms → Bacteria → Terrabacteria group533Open in IMG/M
3300028744|Ga0307318_10270428All Organisms → cellular organisms → Bacteria → Terrabacteria group593Open in IMG/M
3300028768|Ga0307280_10055214All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300028791|Ga0307290_10029161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1953Open in IMG/M
3300028791|Ga0307290_10032390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1858Open in IMG/M
3300028792|Ga0307504_10401096All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300028793|Ga0307299_10385558All Organisms → cellular organisms → Bacteria → Terrabacteria group525Open in IMG/M
3300028802|Ga0307503_10332444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis773Open in IMG/M
3300028807|Ga0307305_10531394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana526Open in IMG/M
3300028810|Ga0307294_10093061Not Available945Open in IMG/M
3300028814|Ga0307302_10045880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2030Open in IMG/M
3300028814|Ga0307302_10654079All Organisms → cellular organisms → Bacteria → Terrabacteria group522Open in IMG/M
3300028819|Ga0307296_10200181All Organisms → cellular organisms → Bacteria → Terrabacteria group1084Open in IMG/M
3300028819|Ga0307296_10231578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium innocens1004Open in IMG/M
3300028824|Ga0307310_10079717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1423Open in IMG/M
3300028875|Ga0307289_10011136All Organisms → cellular organisms → Bacteria3446Open in IMG/M
3300028880|Ga0307300_10210979All Organisms → cellular organisms → Bacteria → Terrabacteria group632Open in IMG/M
3300028885|Ga0307304_10013962All Organisms → cellular organisms → Bacteria → Terrabacteria group2601Open in IMG/M
3300028885|Ga0307304_10572065All Organisms → cellular organisms → Bacteria → Terrabacteria group522Open in IMG/M
3300030496|Ga0268240_10118565All Organisms → cellular organisms → Bacteria → Terrabacteria group632Open in IMG/M
3300030993|Ga0308190_1033565Not Available918Open in IMG/M
3300031057|Ga0170834_106129154Not Available1162Open in IMG/M
3300031058|Ga0308189_10133220All Organisms → cellular organisms → Bacteria → Terrabacteria group832Open in IMG/M
3300031082|Ga0308192_1011311Not Available1058Open in IMG/M
3300031096|Ga0308193_1004098Not Available1452Open in IMG/M
3300031123|Ga0308195_1004890Not Available1325Open in IMG/M
3300031231|Ga0170824_105507969All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031544|Ga0318534_10027789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3064Open in IMG/M
3300031544|Ga0318534_10170187All Organisms → cellular organisms → Bacteria → Terrabacteria group1259Open in IMG/M
3300031544|Ga0318534_10205909All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300031544|Ga0318534_10399444Not Available789Open in IMG/M
3300031564|Ga0318573_10477058Not Available671Open in IMG/M
3300031572|Ga0318515_10110578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1447Open in IMG/M
3300031572|Ga0318515_10495086Not Available652Open in IMG/M
3300031573|Ga0310915_10645088All Organisms → cellular organisms → Bacteria → Terrabacteria group749Open in IMG/M
3300031640|Ga0318555_10206157All Organisms → cellular organisms → Bacteria → Terrabacteria group1060Open in IMG/M
3300031640|Ga0318555_10416476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300031640|Ga0318555_10465361All Organisms → cellular organisms → Bacteria → Terrabacteria group685Open in IMG/M
3300031640|Ga0318555_10566570All Organisms → cellular organisms → Bacteria → Terrabacteria group615Open in IMG/M
3300031668|Ga0318542_10100568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1395Open in IMG/M
3300031668|Ga0318542_10106738All Organisms → cellular organisms → Bacteria → Terrabacteria group1358Open in IMG/M
3300031668|Ga0318542_10265334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium875Open in IMG/M
3300031668|Ga0318542_10655543All Organisms → cellular organisms → Bacteria → Terrabacteria group548Open in IMG/M
3300031679|Ga0318561_10421156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_235734Open in IMG/M
3300031681|Ga0318572_10601296All Organisms → cellular organisms → Bacteria → Terrabacteria group655Open in IMG/M
3300031681|Ga0318572_10876881All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300031681|Ga0318572_10908391All Organisms → cellular organisms → Bacteria → Terrabacteria group523Open in IMG/M
3300031708|Ga0310686_110836656All Organisms → cellular organisms → Bacteria → Terrabacteria group676Open in IMG/M
3300031708|Ga0310686_111733648All Organisms → cellular organisms → Bacteria → Terrabacteria group522Open in IMG/M
3300031719|Ga0306917_11576972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia504Open in IMG/M
3300031720|Ga0307469_12138630All Organisms → cellular organisms → Bacteria → Terrabacteria group544Open in IMG/M
3300031723|Ga0318493_10134214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1270Open in IMG/M
3300031723|Ga0318493_10365241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria786Open in IMG/M
3300031736|Ga0318501_10026100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00822528Open in IMG/M
3300031736|Ga0318501_10367575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300031736|Ga0318501_10372697All Organisms → cellular organisms → Bacteria → Terrabacteria group769Open in IMG/M
3300031744|Ga0306918_11160297Not Available597Open in IMG/M
3300031744|Ga0306918_11461344All Organisms → cellular organisms → Bacteria → Terrabacteria group523Open in IMG/M
3300031744|Ga0306918_11567158All Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300031747|Ga0318502_10186911All Organisms → cellular organisms → Bacteria → Terrabacteria group1195Open in IMG/M
3300031748|Ga0318492_10202062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1017Open in IMG/M
3300031748|Ga0318492_10613137All Organisms → cellular organisms → Bacteria → Terrabacteria group581Open in IMG/M
3300031751|Ga0318494_10765384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae565Open in IMG/M
3300031764|Ga0318535_10125563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1136Open in IMG/M
3300031764|Ga0318535_10202874All Organisms → cellular organisms → Bacteria → Terrabacteria group887Open in IMG/M
3300031765|Ga0318554_10134339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1401Open in IMG/M
3300031765|Ga0318554_10576429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia635Open in IMG/M
3300031765|Ga0318554_10617582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300031765|Ga0318554_10807328All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300031770|Ga0318521_10263090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1009Open in IMG/M
3300031770|Ga0318521_10486014All Organisms → cellular organisms → Bacteria → Terrabacteria group741Open in IMG/M
3300031771|Ga0318546_10319857All Organisms → cellular organisms → Bacteria → Terrabacteria group1076Open in IMG/M
3300031778|Ga0318498_10221188Not Available856Open in IMG/M
3300031779|Ga0318566_10029058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2525Open in IMG/M
3300031779|Ga0318566_10141446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1191Open in IMG/M
3300031779|Ga0318566_10330366Not Available753Open in IMG/M
3300031779|Ga0318566_10354174Not Available724Open in IMG/M
3300031781|Ga0318547_10861864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300031782|Ga0318552_10030264All Organisms → cellular organisms → Bacteria → Terrabacteria group2478Open in IMG/M
3300031794|Ga0318503_10236281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300031795|Ga0318557_10408084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300031796|Ga0318576_10238107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia858Open in IMG/M
3300031799|Ga0318565_10153875All Organisms → cellular organisms → Bacteria → Terrabacteria group1115Open in IMG/M
3300031799|Ga0318565_10395990Not Available670Open in IMG/M
3300031799|Ga0318565_10508239All Organisms → cellular organisms → Bacteria → Terrabacteria group581Open in IMG/M
3300031799|Ga0318565_10528295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300031799|Ga0318565_10558114All Organisms → cellular organisms → Bacteria → Terrabacteria group551Open in IMG/M
3300031805|Ga0318497_10027896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2800Open in IMG/M
3300031805|Ga0318497_10779207All Organisms → cellular organisms → Bacteria → Terrabacteria group536Open in IMG/M
3300031805|Ga0318497_10784230All Organisms → cellular organisms → Bacteria → Terrabacteria group534Open in IMG/M
3300031819|Ga0318568_10094478Not Available1784Open in IMG/M
3300031819|Ga0318568_10263042All Organisms → cellular organisms → Bacteria → Terrabacteria group1069Open in IMG/M
3300031819|Ga0318568_10518821Not Available743Open in IMG/M
3300031819|Ga0318568_10651926All Organisms → cellular organisms → Bacteria → Terrabacteria group655Open in IMG/M
3300031819|Ga0318568_10682519All Organisms → cellular organisms → Bacteria → Terrabacteria group639Open in IMG/M
3300031819|Ga0318568_10780829All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300031821|Ga0318567_10058913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2003Open in IMG/M
3300031823|Ga0307478_10741995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia822Open in IMG/M
3300031824|Ga0307413_11591520All Organisms → cellular organisms → Bacteria → Terrabacteria group580Open in IMG/M
3300031824|Ga0307413_12046272All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300031831|Ga0318564_10168195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus ruber978Open in IMG/M
3300031831|Ga0318564_10193830Not Available905Open in IMG/M
3300031831|Ga0318564_10506100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300031833|Ga0310917_10727304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium672Open in IMG/M
3300031835|Ga0318517_10452533All Organisms → cellular organisms → Bacteria → Terrabacteria group579Open in IMG/M
3300031847|Ga0310907_10777549All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300031852|Ga0307410_10563141All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300031860|Ga0318495_10050827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1836Open in IMG/M
3300031860|Ga0318495_10103045All Organisms → cellular organisms → Bacteria → Terrabacteria group1284Open in IMG/M
3300031880|Ga0318544_10115730All Organisms → cellular organisms → Bacteria → Terrabacteria group1017Open in IMG/M
3300031880|Ga0318544_10378322All Organisms → cellular organisms → Bacteria → Terrabacteria group550Open in IMG/M
3300031896|Ga0318551_10669939All Organisms → cellular organisms → Bacteria → Terrabacteria group600Open in IMG/M
3300031897|Ga0318520_10438827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_235801Open in IMG/M
3300031910|Ga0306923_10542920Not Available1311Open in IMG/M
3300031910|Ga0306923_12074582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia575Open in IMG/M
3300031912|Ga0306921_10354086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1716Open in IMG/M
3300031912|Ga0306921_11167244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria859Open in IMG/M
3300031912|Ga0306921_11513483All Organisms → cellular organisms → Bacteria → Terrabacteria group733Open in IMG/M
3300031912|Ga0306921_12500625Not Available536Open in IMG/M
3300031941|Ga0310912_10454277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria999Open in IMG/M
3300031941|Ga0310912_10778156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria740Open in IMG/M
3300031946|Ga0310910_11402780Not Available538Open in IMG/M
3300031947|Ga0310909_10186519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1719Open in IMG/M
3300031947|Ga0310909_10742926Not Available813Open in IMG/M
3300031947|Ga0310909_11194556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300031954|Ga0306926_10005967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13034Open in IMG/M
3300031954|Ga0306926_12100229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300031959|Ga0318530_10381279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300031981|Ga0318531_10226523Not Available843Open in IMG/M
3300032001|Ga0306922_11603907All Organisms → cellular organisms → Bacteria → Terrabacteria group647Open in IMG/M
3300032008|Ga0318562_10874172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300032009|Ga0318563_10739681All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300032010|Ga0318569_10212393Not Available897Open in IMG/M
3300032013|Ga0310906_10776042All Organisms → cellular organisms → Bacteria → Terrabacteria group675Open in IMG/M
3300032041|Ga0318549_10504982All Organisms → cellular organisms → Bacteria → Terrabacteria group544Open in IMG/M
3300032041|Ga0318549_10532008All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300032042|Ga0318545_10191179Not Available732Open in IMG/M
3300032044|Ga0318558_10225249All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300032052|Ga0318506_10043705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1782Open in IMG/M
3300032052|Ga0318506_10559485All Organisms → cellular organisms → Bacteria → Terrabacteria group506Open in IMG/M
3300032055|Ga0318575_10038239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2145Open in IMG/M
3300032055|Ga0318575_10475334All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300032060|Ga0318505_10417420All Organisms → cellular organisms → Bacteria → Terrabacteria group634Open in IMG/M
3300032063|Ga0318504_10189032All Organisms → cellular organisms → Bacteria → Terrabacteria group959Open in IMG/M
3300032063|Ga0318504_10522192All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300032066|Ga0318514_10288055All Organisms → cellular organisms → Bacteria → Terrabacteria group867Open in IMG/M
3300032067|Ga0318524_10143022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1206Open in IMG/M
3300032067|Ga0318524_10169892All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300032067|Ga0318524_10300029Not Available831Open in IMG/M
3300032067|Ga0318524_10610668All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300032076|Ga0306924_11169612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium834Open in IMG/M
3300032076|Ga0306924_11647236All Organisms → cellular organisms → Bacteria → Terrabacteria group674Open in IMG/M
3300032089|Ga0318525_10202929All Organisms → cellular organisms → Bacteria → Terrabacteria group1019Open in IMG/M
3300032089|Ga0318525_10589080All Organisms → cellular organisms → Bacteria → Terrabacteria group567Open in IMG/M
3300032094|Ga0318540_10641818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300032160|Ga0311301_12083116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia658Open in IMG/M
3300032180|Ga0307471_101887911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria747Open in IMG/M
3300032261|Ga0306920_100129826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3749Open in IMG/M
3300032261|Ga0306920_103243105Not Available608Open in IMG/M
3300032770|Ga0335085_10271714All Organisms → cellular organisms → Bacteria → Terrabacteria group2025Open in IMG/M
3300032783|Ga0335079_11947986Not Available567Open in IMG/M
3300032828|Ga0335080_10888458All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300032892|Ga0335081_10872688All Organisms → cellular organisms → Bacteria → Terrabacteria group1065Open in IMG/M
3300032892|Ga0335081_11528609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces gobiensis737Open in IMG/M
3300032895|Ga0335074_10048350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5869Open in IMG/M
3300032895|Ga0335074_10352848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1634Open in IMG/M
3300033134|Ga0335073_10817915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia996Open in IMG/M
3300033158|Ga0335077_10745232All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300033289|Ga0310914_10502579All Organisms → cellular organisms → Bacteria → Terrabacteria group1097Open in IMG/M
3300033289|Ga0310914_11486457All Organisms → cellular organisms → Bacteria → Terrabacteria group581Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil27.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.13%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.22%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.32%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.77%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.03%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.58%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.58%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.35%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.13%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.13%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.13%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.90%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.90%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.90%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.68%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.68%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.68%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.68%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.45%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.45%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.45%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.45%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.45%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.45%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.23%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.23%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.23%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.23%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.23%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.23%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.23%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.23%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.23%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013045Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027117Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027528Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031082Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031123Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J11755_1157435713300000787SoilVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAS*
JGI10216J12902_12294776323300000956SoilDKGFVVSVGTRRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAQ*
JGI12627J18819_1006630933300001867Forest SoilGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR*
JGIcombinedJ26739_10140598023300002245Forest SoilAGITSGGRMAHLLKDAIEWEYRQSVRHLRGWDPAGR*
C688J35102_11862465423300002568SoilTHRGVAEIAGITTGGRLAHLLKDAIEGEYRQSVKHLRGWDPVAR*
C688J35102_11974431513300002568SoilVSVGTRRGVADVAGITAGGRLAHLLKDVIEWEYRQSVKHLRGWDPVAG*
C688J35102_12079640113300002568SoilHDKGFVVSVGQRRGVADVAGITSGGRLAHLLKDVIEWEYRQSVRHLRGWDPVPL*
JGIcombinedJ51221_1035090623300003505Forest SoilKGFVVSVGTRRGVADIAGITAGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAL*
Ga0058861_1185506823300004800Host-AssociatedRRGVADVAGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG*
Ga0062594_10294046713300005093SoilHDKGFVVSVGTSRGVADVAGVTTGGRLAHLLKDAIEWQYRQSVKHLRGWDPMAR*
Ga0066678_1063896423300005181SoilTRRGVADIAGITTGGRLAHTLKDAIEWEYRQSVKHLRGWDPVAI*
Ga0070658_1046605013300005327Corn RhizosphereRGVADVAGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG*
Ga0066388_10213954123300005332Tropical Forest SoilGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAG*
Ga0068868_10131562923300005338Miscanthus RhizosphereFHDKGFVVSVGTRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVRHLRGWDPIAR*
Ga0070691_1005300413300005341Corn, Switchgrass And Miscanthus RhizosphereVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP*
Ga0070714_10106513513300005435Agricultural SoilFVVSVGTRRGVADIAGLTTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIPG*
Ga0070714_10147988613300005435Agricultural SoilVSVGAERGVADVAGRTIGGRLAGVLKEAIEWEYRQSVKHLRGWSPL*
Ga0070710_1013882213300005437Corn, Switchgrass And Miscanthus RhizosphereFVVSVGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV*
Ga0070710_1096981423300005437Corn, Switchgrass And Miscanthus RhizosphereGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP*
Ga0070710_1106731413300005437Corn, Switchgrass And Miscanthus RhizosphereADIASITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV*
Ga0070700_10136033613300005441Corn, Switchgrass And Miscanthus RhizosphereGFVVSVGARRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKYLRGWDPLAV*
Ga0070694_10164543923300005444Corn, Switchgrass And Miscanthus RhizosphereDKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP*
Ga0070706_10004786813300005467Corn, Switchgrass And Miscanthus RhizosphereDKGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAL*
Ga0070706_10096943733300005467Corn, Switchgrass And Miscanthus RhizosphereRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVTHLRGWDPIAL*
Ga0070706_10189793713300005467Corn, Switchgrass And Miscanthus RhizosphereDKGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR*
Ga0070707_10078153713300005468Corn, Switchgrass And Miscanthus RhizosphereTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR*
Ga0070707_10086992923300005468Corn, Switchgrass And Miscanthus RhizosphereFHDKGFVVSVGTSRGVADIAGITTGGRAARLLKDAIEWEYRQSVRHLRGWDPVAG*
Ga0070707_10127378713300005468Corn, Switchgrass And Miscanthus RhizosphereVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0070707_10175134523300005468Corn, Switchgrass And Miscanthus RhizosphereRGVADIAGITTGGHLAHLLKDAIEWEYRQSVTHLRGWDPIAL*
Ga0070698_10021873253300005471Corn, Switchgrass And Miscanthus RhizosphereKGFVVSVGTRRGVADIAGVTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0070698_10145808713300005471Corn, Switchgrass And Miscanthus RhizosphereVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAL*
Ga0070697_10070637813300005536Corn, Switchgrass And Miscanthus RhizosphereADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAM*
Ga0070732_1080859923300005542Surface SoilSVGTRRGVADIAGITSGGHLAHLLKDAIEWEYRQSVTHLRGWDPIAL*
Ga0070695_10058418513300005545Corn, Switchgrass And Miscanthus RhizosphereTRRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG*
Ga0070665_10026320613300005548Switchgrass RhizosphereGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG*
Ga0070704_10227181713300005549Corn, Switchgrass And Miscanthus RhizosphereADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL*
Ga0066700_1032842013300005559SoilRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIPG*
Ga0068855_10065631513300005563Corn RhizosphereRRGVADIAGITSGGRLAHVLKDVIEWEYRQSVTHLRGWDPLAR*
Ga0066903_10011943513300005764Tropical Forest SoilFVVSVGTSRGVADIAGLTTGGHLAHLLKDAIEWEYRQTVQHLRGWDPIAL*
Ga0066903_10063435413300005764Tropical Forest SoilITSGGKAAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0066903_10804450713300005764Tropical Forest SoilVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0068858_10105395213300005842Switchgrass RhizosphereRDKGFVVSVGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV*
Ga0070717_1060727223300006028Corn, Switchgrass And Miscanthus RhizosphereFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0070717_1074375323300006028Corn, Switchgrass And Miscanthus RhizosphereDIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPAAW*
Ga0075028_10028754613300006050WatershedsFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAL*
Ga0075017_10094854623300006059WatershedsTRRGVADIAGITTGGHLAHLLKDTIEWEYRQSVKHLRGWDPVAR*
Ga0070716_10053190733300006173Corn, Switchgrass And Miscanthus RhizosphereADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP*
Ga0070712_10067954433300006175Corn, Switchgrass And Miscanthus RhizosphereGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPLPG*
Ga0074048_1346587623300006581SoilKGFVVSVGTRRGVADIAGITSGGRLAHLLKDVIEWEYRQSVTHLRGWDPVAR*
Ga0074057_1004385913300006605SoilGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL*
Ga0079222_1148615213300006755Agricultural SoilITTSGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR*
Ga0066660_1123040223300006800SoilGVTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0079221_1081204633300006804Agricultural SoilGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL*
Ga0079220_1015562913300006806Agricultural SoilNRRGVADVAGVTSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG*
Ga0079220_1032689013300006806Agricultural SoilNRRGVADVAGVTSGGRIAHLLKDAIEWEYRQSVKHLRGWDPAA*
Ga0073928_1022320713300006893Iron-Sulfur Acid SpringGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLPG*
Ga0075426_1077975513300006903Populus RhizosphereVSVGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV*
Ga0079219_1126283423300006954Agricultural SoilVVSVGTRRGVADVVGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAM*
Ga0079219_1229640623300006954Agricultural SoilVVGITSGGRMAHLLKDAIEWEYRQSVKHLRGWDPVG*
Ga0079219_1234932113300006954Agricultural SoilAGLTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV*
Ga0099829_1152403023300009038Vadose Zone SoilDIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL*
Ga0099827_10012738103300009090Vadose Zone SoilTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAR*
Ga0099827_1010820823300009090Vadose Zone SoilTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL*
Ga0105240_1124935813300009093Corn RhizosphereIAGITSGGRLAHLLKDAIEWEYRESVRHLRGRDPVAV*
Ga0105240_1246546713300009093Corn RhizosphereVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAM*
Ga0111539_1239290813300009094Populus RhizosphereARRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV*
Ga0105245_1070650513300009098Miscanthus RhizosphereIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG*
Ga0066709_10103132213300009137Grasslands SoilKGFVVSVGTRRGVADIAGITSGGRLAHLLKDGIEWEYRQSVTHLRGWDPLAL*
Ga0066709_10343054123300009137Grasslands SoilSIGDRAGVAELAGITIGGRLAHGLKDAIEWEYRQSVKHLHGFAAV*
Ga0066709_10424929823300009137Grasslands SoilDIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPVAR*
Ga0114129_1276868723300009147Populus RhizosphereDIAGITSGGQLAHLLKDAIEWEYRQSVSHLRGWDPIAR*
Ga0114129_1278994413300009147Populus RhizosphereRGVADIAGITGGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL*
Ga0105241_1097050833300009174Corn RhizosphereVSVGNRRGVADVAGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG*
Ga0105242_1124504613300009176Miscanthus RhizosphereVVSVGTRRGVADIAGITTGGRLAHGLKDAIEWENRQSVKHLRGWDPG*
Ga0105237_1097120313300009545Corn RhizosphereRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV*
Ga0105249_1055943233300009553Switchgrass RhizosphereGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPG*
Ga0116216_1043070823300009698Peatlands SoilDIAGITSAGRLAHLLKDAIEWEYRQSVSHLRGWDPVAL*
Ga0126374_1028668523300009792Tropical Forest SoilFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR*
Ga0123355_1135702133300009826Termite GutFVVSVGPSRGVADIAHITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0126308_1022748043300010040Serpentine SoilFHDKGFVVSVGARRGVADIAGIASGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAR*
Ga0126380_1050061623300010043Tropical Forest SoilGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR*
Ga0126311_1005018343300010045Serpentine SoilSVGARRGVADIAGITGGGQLAHLLKDAIEWEYHQSVRYLRGWDPVAR*
Ga0126384_1057776713300010046Tropical Forest SoilVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIAG*
Ga0126373_1096680113300010048Tropical Forest SoilADIAGITTGGRAAHLLKDAIEWEYRQSVKHLRGWDL*
Ga0126373_1105442713300010048Tropical Forest SoilVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0126373_1243482923300010048Tropical Forest SoilVADIAGITTSGHLAHLLKDAIEWEYRQSVKHLRGWDPLPG*
Ga0126373_1273736113300010048Tropical Forest SoilRRGVADVAGITTGGRLAHLLKDAIEFEYRQSVRHLRGWDPVAV*
Ga0126321_142569613300010145SoilSVGPRRGVAALAGITTGGRLAHVLKDAVEWEYRQSVQRLRGWDPLAV*
Ga0127503_1000392933300010154SoilSVGTHRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG*
Ga0127503_1111342313300010154SoilRRGVADIAGITTGGRLAHGLKDAVEWEYRQSVKHLRGWDPG*
Ga0126370_1085506613300010358Tropical Forest SoilKGFVVSVGTRRGVADIAGITTGGHVAHLLKDAIEWEYRESVKHLRGWDPISQ*
Ga0126370_1229816323300010358Tropical Forest SoilGVADIAGLTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV*
Ga0126376_1055721523300010359Tropical Forest SoilADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR*
Ga0126372_1269232113300010360Tropical Forest SoilGITTGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG*
Ga0126378_1003431743300010361Tropical Forest SoilHDKGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAR*
Ga0126378_1036327433300010361Tropical Forest SoilGDIAGITTGGRAAHLLKDAIEWEYRQAVRHLRGWDPIPG*
Ga0126377_1054421613300010362Tropical Forest SoilRCGVADIAHITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPIA*
Ga0126379_1178963413300010366Tropical Forest SoilADIAGITTGGRMAHLLKDAIEWEYRQSVKHLRGWDPVAR*
Ga0126379_1272050123300010366Tropical Forest SoilFFFSVGTSRGVAEIAGLTTGWLLSNLLKDAIEWEYRQSVKHLRGWDPIAR*
Ga0126379_1314322423300010366Tropical Forest SoilRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV*
Ga0134128_1011633733300010373Terrestrial SoilGFVVSVGTRRGVAGIAGITSGGRLAHLLKDAIEWEYRESVRHLRGRDPVAV*
Ga0126381_10117188113300010376Tropical Forest SoilGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0126381_10164854413300010376Tropical Forest SoilIAGITTGGRLAHLLKDAIEWEYRQCVRHLRGWDPVAR*
Ga0126381_10168449023300010376Tropical Forest SoilFVVSVGTRRGVADIAGVTTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG*
Ga0126381_10188873113300010376Tropical Forest SoilKGFVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPLPG*
Ga0126381_10474066023300010376Tropical Forest SoilDIAGVTTGGKAAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0136449_10309617723300010379Peatlands SoilFVVSVGNRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR*
Ga0136449_10436815713300010379Peatlands SoilKGFVVSIGPRRGVADVAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAM*
Ga0134126_1170171913300010396Terrestrial SoilRLAHVLKDAIEWEYRQSVRHLRGWDPVGPLSRPR*
Ga0134126_1256390523300010396Terrestrial SoilRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKYLRGWDPLAV*
Ga0126383_1227681923300010398Tropical Forest SoilVVSVGTRRGVADIAGITTGGRAAHLLKDAIEWEYRQSVKHLRGWDPLPG*
Ga0134121_1286941623300010401Terrestrial SoilADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP*
Ga0126347_136178023300010867Boreal Forest SoilFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR*
Ga0126347_155504613300010867Boreal Forest SoilDVAGITSGGRLAHLLKDAIEWEYRQSVKHLRGWDL*
Ga0126350_1028762623300010880Boreal Forest SoilHRGVADIASITSGGRLAHLLKDAIEWEYRQSVSHLRGWDPVAR*
Ga0138513_10004404013300011000SoilRRGVADIAGITTGGRLAHLLKDAIEWEYRESVKHLRGWDPLAV*
Ga0151490_173755513300011107SoilGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL*
Ga0126317_1081025913300011332SoilVVSVGTRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVSHLRGWDPIAR*
Ga0137383_1028393313300012199Vadose Zone SoilTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPI*
Ga0137383_1111431723300012199Vadose Zone SoilVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRKSVRHLRGWDPVAR*
Ga0137382_1089826213300012200Vadose Zone SoilVGTSRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAQ*
Ga0137382_1123865013300012200Vadose Zone SoilGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIAR*
Ga0137374_1081238113300012204Vadose Zone SoilHNHGVGGAVGAEHGEADDPGFTTGGRLAHVLKDAIEWEYRQSVKHLRGWDPLAM*
Ga0137379_1135981413300012209Vadose Zone SoilRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGSDPVAV*
Ga0137377_1074936523300012211Vadose Zone SoilVGTRRGVADIAGITTGGHLAHLLKDTIEWEYRQSVKHLRGWDPLPG*
Ga0150985_10506247013300012212Avena Fatua RhizosphereAGITTGGRLAHLLKYAIEWEYRQSVRHLRGWDPFAR*
Ga0150985_10583158613300012212Avena Fatua RhizosphereITTGGRLAHLLKDAIEGEYRQSVKHLRGWDPVAR*
Ga0150985_11452106123300012212Avena Fatua RhizosphereITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLAV*
Ga0137387_1080218023300012349Vadose Zone SoilVVSVGRGRAVADIADITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0137366_1044971513300012354Vadose Zone SoilKGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0137366_1083384513300012354Vadose Zone SoilFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAR*
Ga0137384_1014400063300012357Vadose Zone SoilVSVGTSRGVADIAGITTGGHLAHLLRDAIEWEYRQSVKHLRGWDPIPG*
Ga0137368_1040373723300012358Vadose Zone SoilVTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIAR*
Ga0137385_1132679423300012359Vadose Zone SoilVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0137375_1051574223300012360Vadose Zone SoilDKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0137360_1091103123300012361Vadose Zone SoilRGVADIAGITTGGRLAHLLKDAIEWECRECVRHLRGWDPVAR*
Ga0137390_10018341123300012363Vadose Zone SoilRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL*
Ga0137390_1018897133300012363Vadose Zone SoilIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDSVAR*
Ga0137390_1150841213300012363Vadose Zone SoilFVISIGDRAGAADVAGITLGGRLAHGLKDAIEWEYRQSVKYLRGFAAV*
Ga0150984_10550732223300012469Avena Fatua RhizosphereGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR*
Ga0157303_1004033713300012896SoilIAGITSGGRLTHLLKDLIEWEYRQSVTHLRGWDPLAS*
Ga0137395_1045390623300012917Vadose Zone SoilVVSVGTRRGVADIAGITSGGHLAHLLKDAIEWEYRQSVTHLRGWDPVAL*
Ga0137407_1076581533300012930Vadose Zone SoilSVGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV*
Ga0137407_1077396913300012930Vadose Zone SoilDKGFVVSVGTRRGVADIAGIIAGGRLAHLLKDAIEWEYRQSVKHLRGWDPV*
Ga0164303_1154195313300012957SoilRRGVADIAGITGGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL*
Ga0164302_1023121913300012961SoilGFVVSVGTRRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG*
Ga0126369_1078296713300012971Tropical Forest SoilVSVGTSRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0126369_1177905223300012971Tropical Forest SoilSVGTRRGDADIAGITTGGHVAHLLKDAIEWEYRESVKHLRGWDPISQ*
Ga0126369_1205472313300012971Tropical Forest SoilKGFVVSVGPRRGVADIAGITSGGKAAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0126369_1246756813300012971Tropical Forest SoilLHDKGIVVSVGPTRGVAEVLGHPFAGRLAHALKDAIEWEYRASVQHLRGWSPV*
Ga0126369_1331019913300012971Tropical Forest SoilVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0154016_14144933300013045Corn, Switchgrass And Miscanthus RhizosphereVVSVGTRRGVADIAGITTGGRLAHVLKDAIEWEYRQSVRHLRGWDPVGPLSRPR*
Ga0157370_1194242413300013104Corn RhizosphereHDKGFVVSVGTRRGVAGITSGGRLAHLLKDAIEWEYRESVRHLRGRDP*
Ga0157374_1027888113300013296Miscanthus RhizosphereLREHGFGVSAAPRRGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP*
Ga0163162_1074496313300013306Switchgrass RhizosphereVVSVGTRRVVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG*
Ga0163162_1123687713300013306Switchgrass RhizosphereRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAQ*
Ga0134078_1045447423300014157Grasslands SoilITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0134079_1046114823300014166Grasslands SoilSVGTRRGVADIAGITTGGRLAHRLKDAIEWEYRQSVKHLRGWDPV*
Ga0134079_1065288323300014166Grasslands SoilVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPVAR*
Ga0134085_1050043423300015359Grasslands SoilGVADVAGVTAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR*
Ga0132258_1118281143300015371Arabidopsis RhizosphereGFVVSVGTRRGVADIAGISSGGRLAHLLKDIIEWEERQSVTHLRGWDPLAR*
Ga0132258_1368403713300015371Arabidopsis RhizosphereIAGVTTGGHVAHLLKDAIEWEYRQSVKHLRGWDPLPG*
Ga0182041_1208410013300016294SoilHDKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0182033_1037052123300016319SoilADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0182033_1090588813300016319SoilGTRRGVADIAGITTGGRLAHLLKDAIEWDYRQSVRHLRGWDPVAATARPSRSCQN
Ga0182033_1163101313300016319SoilGTRRGVADIAGITTGGRLAHVLKDAIEWEYRQSVKHLRGWDPVAL
Ga0182033_1209683723300016319SoilFVVSVGTRRGVADVAGITTGGRLAHLLKDAIEWEYRQSVKHMRGWDPLA
Ga0182032_1027391023300016357SoilAVADIAGVTSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG
Ga0182034_1080171923300016371SoilAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0182040_1083917533300016387SoilRGVADIAGITTGGRLAHLLKDTIEWEYRQSVRHLRGWDPVAR
Ga0182037_1074646013300016404SoilKGFVVSVGTRRGVADVAGITTGGRLAHLLKDAIEWEYRQSVKHMRGWDPLA
Ga0182039_1024335313300016422SoilVGTRRGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0182038_1114587223300016445SoilHDKGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0182038_1127273623300016445SoilRDKGFVVSVGTRRAVADIAGITSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG
Ga0182038_1165290813300016445SoilHDKGFVISVGTRRGVVNIAGITTGGRLAHLLKDAIEWEYRQSVTHLRG
Ga0134074_134171513300017657Grasslands SoilHDKGFVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPV
Ga0187820_118181123300017924Freshwater SedimentVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0187807_107920813300017926Freshwater SedimentIPHITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVSR
Ga0187806_109091823300017928Freshwater SedimentRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0187809_1023109213300017937Freshwater SedimentVGTRRGVADIAGLTTGGRLTHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0187808_1008697513300017942Freshwater SedimentADIAGVTTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0187808_1030300423300017942Freshwater SedimentGAHRGVADIARITIGGRMAHLLKDAIEWEYRQSVRHLRGWDPVNA
Ga0187808_1046996213300017942Freshwater SedimentKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0187780_1000579113300017973Tropical PeatlandGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0187777_1041473013300017974Tropical PeatlandGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0187777_1134770823300017974Tropical PeatlandAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0184610_131409913300017997Groundwater SedimentSVGARRGVADIAGITSGGQLAHLLKDAIEWEYRQSVSHLRSWDPVAR
Ga0184621_1010484023300018054Groundwater SedimentFVVSVGTRRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPIAR
Ga0184621_1018339613300018054Groundwater SedimentDKGFVVSVGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVSHLRSWDPVAR
Ga0187766_10008509103300018058Tropical PeatlandVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0187766_1143167713300018058Tropical PeatlandDKGFVVSVGTRRGVADIAGLTTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0187765_1044746023300018060Tropical PeatlandGFVVSVGTRRGVADIAGITTGGRAAHLLKDAIEWEYRQSVKHLRGWDPVPG
Ga0184619_1014807423300018061Groundwater SedimentFVVSVGTRRGVADIASITSGGQLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0184609_1025046223300018076Groundwater SedimentVVSVGTRRGVADIASITSGGQLAHLLKDAIEWEYRQSVSHLRSWDPVAR
Ga0184625_1047162813300018081Groundwater SedimentVGTRRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPIAR
Ga0184625_1060629713300018081Groundwater SedimentIAGITTGGQLAHLLKDAIEWEYRQSVSHLRGWDPVAR
Ga0187774_1109725323300018089Tropical PeatlandSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0190272_1271988113300018429SoilDKGFVVSVGTRRGVADIAGITTGGRLAHLLKDTIEWEYRQSVRHLRGWDPVAR
Ga0190275_1145889023300018432SoilVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0066667_1102488123300018433Grasslands SoilSVGTSRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAQ
Ga0190273_1013510733300018920SoilVADIAGITTGGRLAHLLKDTIEWEYRQSVRHLRGWDPVAR
Ga0173481_1025429613300019356SoilVADIAGITSGGQLAHLLKDAIEWEYRQSVRHLRGWDPIAG
Ga0193704_100842413300019867SoilVVSVGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAM
Ga0193738_110040223300020020SoilSVGARRGVAHIADITTGGRLAHVLKDAIEWEYRESVKHLRGWDPLTV
Ga0206356_1077860013300020070Corn, Switchgrass And Miscanthus RhizosphereRRGVADIAGITTGGRLAHLLKDAIEWEYCQSVRHLRG
Ga0206356_1106746013300020070Corn, Switchgrass And Miscanthus RhizosphereRRGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP
Ga0206354_1006611513300020081Corn, Switchgrass And Miscanthus RhizosphereRRGVADIAGITSGGRLAHFLKDAIEWEYRQSVKHLRGWDPATL
Ga0206353_1087907733300020082Corn, Switchgrass And Miscanthus RhizosphereVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPAA
Ga0210403_1074992133300020580SoilRGVADIAGITTGGRLAHRLKDAIEWEYRQSVKHLRGWDPV
Ga0210399_1017351133300020581SoilGVADIAGITTGGRLAHRLKDAIEWEYRQSVKHLRGWDPV
Ga0210399_1113452623300020581SoilGITSGGQLAHLLKDAIEWEYRQSVKHLRGWDPVPG
Ga0210399_1135381813300020581SoilGTRRGVAGIAGITTGGRLAHLLKDAIEWEYRQSVTHLRGWDPV
Ga0210401_1045331333300020583SoilDKWFVVSVGTRRGVADIADITTSGRLAHLLKDAIEWEYRQSVRHLRGWDPVAI
Ga0210381_1003356433300021078Groundwater SedimentGTRRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPIAR
Ga0210408_1091291213300021178SoilVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVTHLRGWDPV
Ga0210385_1087835813300021402SoilGVADVAGITSGGRTAHLLKDAIEWEYRQSVRHLRGWDPTAR
Ga0210389_1033988633300021404SoilADIASITTSGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0210383_1112151813300021407SoilGVADIADITTSGRLAHLLKDAIEWEYRQSVRHLRGWDPVAI
Ga0210398_1009271933300021477SoilRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAL
Ga0210402_1011040553300021478SoilVSVGTSRGVADVAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAG
Ga0210402_1047630333300021478SoilIAGITTGGRLAHRLKDAIEWEYRQSVKHLRGWDPV
Ga0210409_1052759823300021559SoilHDKGFVVSVGTSRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIPG
Ga0210409_1099918413300021559SoilDIADITTSGRLAHLLKDAIEWEYRQSVRHLRGWDPVAI
Ga0224712_1005246213300022467Corn, Switchgrass And Miscanthus RhizosphereVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLHGWDPVS
Ga0222622_1015612933300022756Groundwater SedimentADIAGITSGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAM
Ga0222622_1114874413300022756Groundwater SedimentLGRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVSHLRSWDPVAR
Ga0247788_107256013300022901SoilDIAGITSGGRLTHLLKDLIEWEYRQSVTHLRGWDPLAS
Ga0247678_107118223300024325SoilIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP
Ga0207684_1077671213300025910Corn, Switchgrass And Miscanthus RhizosphereVGTSRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIPG
Ga0207684_1092869213300025910Corn, Switchgrass And Miscanthus RhizosphereRRGVADVAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAM
Ga0207684_1153979113300025910Corn, Switchgrass And Miscanthus RhizosphereIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPAAW
Ga0207671_1085112833300025914Corn RhizosphereIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV
Ga0207693_1064799723300025915Corn, Switchgrass And Miscanthus RhizosphereVGTRRGVADIVGIATGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAR
Ga0207663_1062958413300025916Corn, Switchgrass And Miscanthus RhizosphereVSVGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPG
Ga0207663_1173813513300025916Corn, Switchgrass And Miscanthus RhizosphereVADIAGITSGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0207652_1035162733300025921Corn RhizosphereADVAGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG
Ga0207652_1045341443300025921Corn RhizosphereGVADIAGITTGGRLAHVLKDAIEWEYRQSVRHLRGWDPVGPLSRPR
Ga0207652_1164653813300025921Corn RhizosphereGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV
Ga0207646_1065268813300025922Corn, Switchgrass And Miscanthus RhizosphereRGVADIAGITTGGHLAHLLKDAIEWEYRQSVTHLRGWDPIAL
Ga0207646_1082496313300025922Corn, Switchgrass And Miscanthus RhizosphereGVADIVGIATGGRLAHLLKDAIEWEYRQSVTHLRGWDPIAR
Ga0207681_1102462433300025923Switchgrass RhizosphereRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV
Ga0207687_1017039213300025927Miscanthus RhizosphereADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPG
Ga0207706_1107912013300025933Corn RhizosphereFVVSVGTRRGVADIAGISSGGRLAHLLKDIIEWEYRQSVTHLRGWDPLAR
Ga0207665_1032639933300025939Corn, Switchgrass And Miscanthus RhizosphereVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPVG
Ga0207665_1098360713300025939Corn, Switchgrass And Miscanthus RhizosphereVGTRRGVAEIASITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0207711_1054858033300025941Switchgrass RhizosphereDIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV
Ga0207689_1080026613300025942Miscanthus RhizosphereSVGTRRGVADIAGISSGGRLAHLLKDIIEWEYRQSVTHLRGWDPLAR
Ga0207661_1190161223300025944Corn RhizospherePRRGVADFAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0207667_1039425433300025949Corn RhizosphereTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV
Ga0207712_1119052513300025961Switchgrass RhizosphereKGFVVSVGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV
Ga0207640_1146715023300025981Corn RhizosphereGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV
Ga0207677_1039604933300026023Miscanthus RhizosphereRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPG
Ga0207678_1089016733300026067Corn RhizosphereVGTRRGVADVAGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG
Ga0207702_1181072523300026078Corn RhizosphereGVADVAGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG
Ga0207648_1079725623300026089Miscanthus RhizosphereVAVSLVADIAGITTGGRLAHLLKDAIEWEYRQSVKYLRGWDPLAV
Ga0209648_1063888323300026551Grasslands SoilGVADIAGITTGGHLAHLLKDAIEWEYRQSVTHLRGWDPVAR
Ga0209732_108799523300027117Forest SoilGTHRGVVDIAGITSGGHLAHLLKDAIEWEYRQSVKHLRGWDPVPG
Ga0208985_104180513300027528Forest SoilVSVGTRRGVADVAGVTSGGRMAHVLKDAIEWEYRQSVKHLHGWDPAG
Ga0209178_122014813300027725Agricultural SoilRRGVADIAGLTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0209328_1015680613300027727Forest SoilFHDKGFVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0209693_1021635323300027855SoilGVADIAGITSGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0209283_1009082413300027875Vadose Zone SoilIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL
Ga0209590_1003915463300027882Vadose Zone SoilSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGSDPVAV
Ga0209488_1006430533300027903Vadose Zone SoilGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAM
Ga0209006_1010546343300027908Forest SoilTHRGVADVAGITSGGRAAHLLKDAIEWEYRQSVKHLRGWDPVPG
Ga0209526_1078187723300028047Forest SoilVADIAGITSGGRMAHLLKDAIEWEYRQSVRHLRGWDPAGR
Ga0247675_101622323300028072SoilGFVVSVGTRRGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP
Ga0268265_1206588013300028380Switchgrass RhizosphereVGTSRGVADIAGITTGGRLAHVLKDAIEWEYRQSVKHLRGWSPVTR
Ga0137415_1018558313300028536Vadose Zone SoilVVSVGTRRGVADIAGVTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0247828_1084553613300028587SoilVGTRRGVADIAGFTSGGKLAHLLKDAIEWEYRQSVKHLRGWDPIG
Ga0247821_1016870033300028596SoilFVVSVGTSRGVADVAGVTTGGRLAHLLKDAIEWQYRQSVKHLRGWDPMAR
Ga0247820_1039625223300028597SoilRGVADVAGVTTGGRLAHLLKDAIEWQYRQSVKHLRGWDPMAR
Ga0307298_1000161773300028717SoilGFVVSVGARRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG
Ga0307319_1029786513300028722SoilVVSVGARRGVADIAGITSGGQLAHLLKDAIEWEYRQSVSHLRGWDPVAR
Ga0307318_1027042823300028744SoilRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVSHLRSWDPVAR
Ga0307280_1005521413300028768SoilHDKGFVVSVGARRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLAV
Ga0307290_1002916113300028791SoilRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV
Ga0307290_1003239033300028791SoilGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAM
Ga0307504_1040109623300028792SoilADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0307299_1038555813300028793SoilVVSVGARRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLAV
Ga0307503_1033244413300028802SoilGITTGGQLAHLLKDAIEWEYRQSVRHLRGWSPVTR
Ga0307305_1053139423300028807SoilAGITTGGQLAHLLKDAIEWEYRQSVTHLRGWDPLAS
Ga0307294_1009306123300028810SoilYKGFVVSVGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAM
Ga0307302_1004588033300028814SoilVGARRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV
Ga0307302_1065407913300028814SoilPRRGVAALAGITTGGRLAHVLKDAVEWEYRQSVQRLRGWDPLAV
Ga0307296_1020018113300028819SoilFVVSVGARRGVADIAGITTGGRLAHLLKDAIEWEYRESVKHLRGWDPLTV
Ga0307296_1023157813300028819SoilVGTRRGVADIAGITTGGRLAHRLKDAIEWEYRQSVKHLRGWDPV
Ga0307310_1007971713300028824SoilRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAM
Ga0307289_1001113663300028875SoilRGVADIGGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV
Ga0307300_1021097913300028880SoilDIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLAV
Ga0307304_1001396213300028885SoilDIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV
Ga0307304_1057206523300028885SoilFHDKGFVVSVGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAM
Ga0268240_1011856513300030496SoilFHDKGFVVSVGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVKHLRGWDPVAH
Ga0308190_103356523300030993SoilGARRGVADIGGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV
Ga0170834_10612915423300031057Forest SoilVSVGTRRGVADIAGITTGGRSAHLLKDAIEWEYRQSIRHLRGWDPVAR
Ga0308189_1013322013300031058SoilVVSVGTRRGAADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG
Ga0308192_101131123300031082SoilSVGARRGVADIGGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV
Ga0308193_100409813300031096SoilGFVVSVGARRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV
Ga0308195_100489013300031123SoilDIGGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV
Ga0170824_10550796913300031231Forest SoilDIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG
Ga0318534_1002778913300031544SoilVADIAGITTGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318534_1017018713300031544SoilRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318534_1020590923300031544SoilADIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG
Ga0318534_1039944413300031544SoilAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0318573_1047705813300031564SoilDIAGVTSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG
Ga0318515_1011057833300031572SoilGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318515_1049508623300031572SoilDKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0310915_1064508823300031573SoilDKGFVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPLPG
Ga0318555_1020615713300031640SoilGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0318555_1041647613300031640SoilAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWNPVAV
Ga0318555_1046536123300031640SoilVVSVGTRRGVAGIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR
Ga0318555_1056657023300031640SoilVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHMRGWDPVAL
Ga0318542_1010056813300031668SoilVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318542_1010673813300031668SoilVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318542_1026533423300031668SoilDKGFVVSVGTRRGVADVAGITTGGRLAHLLKDAIEWEYRQSVKHMRGWDPLA
Ga0318542_1065554313300031668SoilDKGFVVSVGTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318561_1042115613300031679SoilTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318572_1060129613300031681SoilRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0318572_1087688123300031681SoilFVVSVGPRRAVADIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG
Ga0318572_1090839113300031681SoilADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR
Ga0310686_11083665623300031708SoilDKGFVVSVGTRHGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPIAR
Ga0310686_11173364813300031708SoilVADIAAITTSGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0306917_1157697223300031719SoilDIAGITTGGRLAHVLKDAIEWEYRQSVKHLRGWDPVAL
Ga0307469_1213863013300031720Hardwood Forest SoilGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL
Ga0318493_1013421413300031723SoilGFVVSVGTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHMRGWDPVAL
Ga0318493_1036524133300031723SoilTRRGVADIAGVTTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAL
Ga0318501_1002610013300031736SoilSRGVADIAGITSGGHAAHLLKDAIEWEYRQSVRHLRGWDPVPG
Ga0318501_1036757533300031736SoilTRRGVADIAGITTGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318501_1037269723300031736SoilTSRGVADVAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0306918_1116029713300031744SoilGVADIAGVTSGGRLAHLLKDAIEWEYRQSVSHLRGWDPVAM
Ga0306918_1146134413300031744SoilVGTRRGVADIVGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0306918_1156715813300031744SoilRGVADIAGLTTGGHLAHLLKDAIEWEYRQTVKHLRGWDPIAL
Ga0318502_1018691123300031747SoilGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVPG
Ga0318492_1020206233300031748SoilGFVVSVGTRRGVADIAGITTGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318492_1061313713300031748SoilFHDKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR
Ga0318494_1076538413300031751SoilAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318535_1012556313300031764SoilVSVGTRRGVAGIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318535_1020287423300031764SoilKGFVVSVGTRRGVADIAGITTGGRSAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318554_1013433933300031765SoilGFVVSVGTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAL
Ga0318554_1057642913300031765SoilFHDKGFVVSVGTRRGVADIANITTSGRLAHLLKDSIEWEYRQSVRHLRGWDPVAV
Ga0318554_1061758213300031765SoilFHDRGFVVSVGTSRGVAEIAGLTAGGHLAHLLKDAIEWEYRQSVKHLHGWDPVAR
Ga0318554_1080732823300031765SoilKGFVVSVGTRRGVADIAGVTSGGHLAHLLKDAIEWEYRQSVRHMRGWDPVAL
Ga0318521_1026309033300031770SoilVADIAGITSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG
Ga0318521_1048601413300031770SoilGFVVSVGTRRGVADIAGITTGGRLAHLLKDSIEWEYRQSVRHLRGWDPIAR
Ga0318546_1031985713300031771SoilFHDKGFVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPIAR
Ga0318498_1022118813300031778SoilAGITSGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0318566_1002905813300031779SoilDKGFVVSVGTSRGVADIAGITSGGHAAHLLKDAIEWEYRQSVRHLRGWDPVPG
Ga0318566_1014144623300031779SoilKGFVVSVGTRRGVADIAGITTGGRLAHVLKDAIEWEYRQSVKHLRGWDPVAL
Ga0318566_1033036613300031779SoilTRRAVADIAGITSGGRVAHLLKDAIEWEYRQSVRHLRGWDPIPG
Ga0318566_1035417413300031779SoilFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318547_1086186413300031781SoilTRRGVADIAGITTGGRLAHLLKDTIEWEYRQSVRHLRGWDPVAR
Ga0318552_1003026413300031782SoilVFEQVGRPVADIAGVTSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG
Ga0318503_1023628113300031794SoilKGFVVSVGTRRGVADVAGITTGGRVAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0318557_1040808413300031795SoilADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318576_1023810713300031796SoilFHDKGFVVSVGTRRGVADVAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318565_1015387513300031799SoilVSVGTRRGVADIAGITTGGRSAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318565_1039599023300031799SoilGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0318565_1050823923300031799SoilFSVGIRRGVADIAGVTTDGRLAHLLKDAIEWEYRQSVRHMRGWDPVAL
Ga0318565_1052829513300031799SoilGVADIAGITSGGHVAHLLKDAIEWEYRQSVRHLRGWDPVQG
Ga0318565_1055811413300031799SoilIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR
Ga0318497_1002789643300031805SoilDKGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318497_1077920713300031805SoilGFVVSVGTRRGVADIAGITTGGRLAHLLKDTIEWEYRQSVRHLRGWDPVAR
Ga0318497_1078423013300031805SoilFVVSVGTRRGVADIAGMTTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0318568_1009447813300031819SoilGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0318568_1026304213300031819SoilDVAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0318568_1051882113300031819SoilADIANITTSGRLAHLLKDSIEWEYRQSVRHLRGWDPVAV
Ga0318568_1065192613300031819SoilGCNAGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAV
Ga0318568_1068251913300031819SoilVGTRRGVADIAAITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG
Ga0318568_1078082923300031819SoilGFVVSVGTRRGVADIAGVTTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318567_1005891343300031821SoilVSVGTRRAVADIAGITSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG
Ga0307478_1074199523300031823Hardwood Forest SoilDKGFVVSVGTSRGVADIAGITTGGRAAHLLKDAIEWEYRQSVRHLRG
Ga0307413_1159152023300031824RhizosphereVVSVGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0307413_1204627223300031824RhizosphereKGFVVSVGMRRGVADVAGVTMGGRLAHVLKDAIEWEYRQSVKYLRGWDPLAL
Ga0318564_1016819513300031831SoilHDKGFVVSVGTRRGVADIAGITTGGRLAHLLKDTIEWEYRQSVRHLRGWDPVAR
Ga0318564_1019383013300031831SoilGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318564_1050610023300031831SoilVGTRRGVADVAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0310917_1072730423300031833SoilVADVAGITTGGRLAHLLKDAIEWEYRQSVKHMRGWDPLA
Ga0318517_1045253323300031835SoilTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0310907_1077754923300031847SoilDIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVIR
Ga0307410_1056314113300031852RhizosphereFHEKRFVVSVGASRGVADIADITTGGRLAHLLKDAIEWEYRESVKHLRGWDPLAV
Ga0318495_1005082713300031860SoilADVAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318495_1010304513300031860SoilDKGFVVSVGTRRGVAGIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR
Ga0318544_1011573013300031880SoilVGTRRGVAGIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPIAR
Ga0318544_1037832213300031880SoilHDKGFVVSVGTRRGVADIAGMTTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0318551_1066993913300031896SoilVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318520_1043882713300031897SoilRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0306923_1054292043300031910SoilRGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0306923_1207458223300031910SoilVSVGTRRGVADIAGVTTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAH
Ga0306921_1035408613300031912SoilAGLTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0306921_1116724433300031912SoilFVVSVGTRRGVADIAGITTGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0306921_1151348323300031912SoilTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVPG
Ga0306921_1250062523300031912SoilVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0310912_1045427733300031941SoilHDKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0310912_1077815613300031941SoilGVADIAGITTGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0310910_1140278013300031946SoilRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAI
Ga0310909_1018651913300031947SoilFVVSVGTRRGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0310909_1074292623300031947SoilKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0310909_1119455623300031947SoilSRGVAEIAGFTAGGHLAHLLKDAIEWEYRQSVKHLHGWDPVAR
Ga0306926_10005967143300031954SoilGPRRAVADIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG
Ga0306926_1210022913300031954SoilFVVSVGTRRGVADIAGITTGGRLAHVLKDAIEWEYRQSVKHLRGWDPVAL
Ga0318530_1038127913300031959SoilGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318531_1022652323300031981SoilVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0306922_1160390713300032001SoilVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0318562_1087417223300032008SoilRGVADIAGITTGGRLAHVLKDAIEWEYRQSVKHLRGWDPVAL
Ga0318563_1073968113300032009SoilADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAR
Ga0318569_1021239313300032010SoilTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0310906_1077604213300032013SoilADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV
Ga0318549_1050498213300032041SoilDIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAL
Ga0318549_1053200823300032041SoilRGVADIADITTGGLAHLLKDAIEREYRQSVRHLRGWDPVAV
Ga0318545_1019117923300032042SoilVADIAGVTSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG
Ga0318558_1022524913300032044SoilGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318506_1004370513300032052SoilGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAL
Ga0318506_1055948523300032052SoilVSVGPRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR
Ga0318575_1003823953300032055SoilTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318575_1047533423300032055SoilVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAR
Ga0318505_1041742013300032060SoilVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318504_1018903223300032063SoilKGFVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPIAR
Ga0318504_1052219213300032063SoilVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAV
Ga0318514_1028805513300032066SoilGTRRGVADIAGLTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR
Ga0318524_1014302213300032067SoilGITTGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318524_1016989213300032067SoilVVSVGPRRAVADIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG
Ga0318524_1030002913300032067SoilSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0318524_1061066813300032067SoilVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG
Ga0306924_1116961213300032076SoilRGVADVAGITTGGRLAHLLKDAIEWEYRQSVKHMRGWDPLA
Ga0306924_1164723613300032076SoilAGITTGGHLAHLLKDAIEWEYRQSVQHLHGWDPIAR
Ga0318525_1020292913300032089SoilFVVSVGTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0318525_1058908023300032089SoilVSVGTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHMRGWDPVAL
Ga0318540_1064181813300032094SoilVADVAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0311301_1208311623300032160Peatlands SoilHDKGFVVSVGNRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR
Ga0307471_10188791113300032180Hardwood Forest SoilGVTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0306920_10012982613300032261SoilGFVVSVGTRRGVADIAGITTGGRSAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0306920_10324310513300032261SoilGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0335085_1027171443300032770SoilRRGVADIAGITSGGRLAHVLKDAIEWEYRQSVRHLRGWDPVAR
Ga0335079_1194798613300032783SoilVSVGTRRGVAEIAGITTGGRLAHLLKDAIEWEYRESVRHLRGWDPVAV
Ga0335080_1088845833300032828SoilVSVGTRRGVADIAGITTSGRLAHLLKDAIEWEYRESVRHLRGWDPVAV
Ga0335081_1087268823300032892SoilFHDKGFVASVGTHRGVADIAGITTGGRIAHLLKDAIEWEYRQSVKHLRGWDPVNV
Ga0335081_1152860913300032892SoilFVVSVGTRRGVADVAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0335074_1004835093300032895SoilVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAA
Ga0335074_1035284813300032895SoilVADIARVTIGGRLAHLLEDAIEWEYREPVKDLRGWAQ
Ga0335073_1081791513300033134SoilVGPRRGVADIAGTTIGGRVAHLLKDAIEWEYRESVKHLRGWDPVTL
Ga0335077_1074523213300033158SoilRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV
Ga0310914_1050257913300033289SoilVVSVGTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR
Ga0310914_1148645713300033289SoilGTSRGVADIAGITSGGHAAHLLKDAIEWEYRQSVRHLRGWDPIAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.