| Basic Information | |
|---|---|
| Family ID | F004332 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 443 |
| Average Sequence Length | 45 residues |
| Representative Sequence | GTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Number of Associated Samples | 299 |
| Number of Associated Scaffolds | 443 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.23 % |
| % of genes near scaffold ends (potentially truncated) | 99.55 % |
| % of genes from short scaffolds (< 2000 bps) | 92.78 % |
| Associated GOLD sequencing projects | 280 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.585 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.540 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.700 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.826 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 443 Family Scaffolds |
|---|---|---|
| PF01575 | MaoC_dehydratas | 3.16 |
| PF04679 | DNA_ligase_A_C | 2.71 |
| PF11139 | SfLAP | 2.48 |
| PF04224 | DUF417 | 2.03 |
| PF12697 | Abhydrolase_6 | 1.58 |
| PF07883 | Cupin_2 | 1.58 |
| PF00196 | GerE | 1.35 |
| PF00144 | Beta-lactamase | 1.35 |
| PF08670 | MEKHLA | 1.35 |
| PF00248 | Aldo_ket_red | 1.35 |
| PF13271 | DUF4062 | 1.13 |
| PF03537 | Glyco_hydro_114 | 1.13 |
| PF13378 | MR_MLE_C | 1.13 |
| PF07859 | Abhydrolase_3 | 1.13 |
| PF00905 | Transpeptidase | 1.13 |
| PF13191 | AAA_16 | 0.90 |
| PF00730 | HhH-GPD | 0.90 |
| PF01565 | FAD_binding_4 | 0.90 |
| PF07690 | MFS_1 | 0.90 |
| PF13419 | HAD_2 | 0.90 |
| PF13602 | ADH_zinc_N_2 | 0.68 |
| PF02979 | NHase_alpha | 0.68 |
| PF00004 | AAA | 0.68 |
| PF08241 | Methyltransf_11 | 0.68 |
| PF00561 | Abhydrolase_1 | 0.68 |
| PF00027 | cNMP_binding | 0.68 |
| PF12270 | Cyt_c_ox_IV | 0.68 |
| PF07992 | Pyr_redox_2 | 0.68 |
| PF01243 | Putative_PNPOx | 0.68 |
| PF01609 | DDE_Tnp_1 | 0.68 |
| PF13581 | HATPase_c_2 | 0.68 |
| PF13561 | adh_short_C2 | 0.45 |
| PF01979 | Amidohydro_1 | 0.45 |
| PF01636 | APH | 0.45 |
| PF00005 | ABC_tran | 0.45 |
| PF05988 | DUF899 | 0.45 |
| PF01370 | Epimerase | 0.45 |
| PF01425 | Amidase | 0.45 |
| PF00406 | ADK | 0.45 |
| PF00881 | Nitroreductase | 0.45 |
| PF00941 | FAD_binding_5 | 0.45 |
| PF00583 | Acetyltransf_1 | 0.45 |
| PF00440 | TetR_N | 0.45 |
| PF01738 | DLH | 0.45 |
| PF08031 | BBE | 0.45 |
| PF11716 | MDMPI_N | 0.45 |
| PF00106 | adh_short | 0.45 |
| PF14863 | Alkyl_sulf_dimr | 0.45 |
| PF02627 | CMD | 0.23 |
| PF06224 | HTH_42 | 0.23 |
| PF03795 | YCII | 0.23 |
| PF03551 | PadR | 0.23 |
| PF01596 | Methyltransf_3 | 0.23 |
| PF05173 | DapB_C | 0.23 |
| PF02371 | Transposase_20 | 0.23 |
| PF00392 | GntR | 0.23 |
| PF06912 | DUF1275 | 0.23 |
| PF03706 | LPG_synthase_TM | 0.23 |
| PF02133 | Transp_cyt_pur | 0.23 |
| PF03704 | BTAD | 0.23 |
| PF04198 | Sugar-bind | 0.23 |
| PF01872 | RibD_C | 0.23 |
| PF01625 | PMSR | 0.23 |
| PF00291 | PALP | 0.23 |
| PF01068 | DNA_ligase_A_M | 0.23 |
| PF02577 | BFN_dom | 0.23 |
| PF01152 | Bac_globin | 0.23 |
| PF13847 | Methyltransf_31 | 0.23 |
| PF13474 | SnoaL_3 | 0.23 |
| PF04542 | Sigma70_r2 | 0.23 |
| PF03176 | MMPL | 0.23 |
| PF00115 | COX1 | 0.23 |
| PF13460 | NAD_binding_10 | 0.23 |
| PF02776 | TPP_enzyme_N | 0.23 |
| PF14534 | DUF4440 | 0.23 |
| PF13230 | GATase_4 | 0.23 |
| PF00384 | Molybdopterin | 0.23 |
| PF15420 | Abhydrolase_9_N | 0.23 |
| PF00141 | peroxidase | 0.23 |
| PF00072 | Response_reg | 0.23 |
| PF06736 | TMEM175 | 0.23 |
| PF04820 | Trp_halogenase | 0.23 |
| PF05199 | GMC_oxred_C | 0.23 |
| PF12146 | Hydrolase_4 | 0.23 |
| PF10081 | Abhydrolase_9 | 0.23 |
| PF07929 | PRiA4_ORF3 | 0.23 |
| PF00355 | Rieske | 0.23 |
| PF08338 | DUF1731 | 0.23 |
| PF01726 | LexA_DNA_bind | 0.23 |
| PF13424 | TPR_12 | 0.23 |
| PF08044 | DUF1707 | 0.23 |
| PF13480 | Acetyltransf_6 | 0.23 |
| PF01263 | Aldose_epim | 0.23 |
| PF00033 | Cytochrome_B | 0.23 |
| PF03649 | UPF0014 | 0.23 |
| PF00665 | rve | 0.23 |
| PF05496 | RuvB_N | 0.23 |
| PF00266 | Aminotran_5 | 0.23 |
| PF00589 | Phage_integrase | 0.23 |
| PF04978 | DUF664 | 0.23 |
| PF01238 | PMI_typeI_C | 0.23 |
| PF02517 | Rce1-like | 0.23 |
| PF03466 | LysR_substrate | 0.23 |
| COG ID | Name | Functional Category | % Frequency in 443 Family Scaffolds |
|---|---|---|---|
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 2.93 |
| COG3059 | Reactive chlorine resistance protein RclC/YkgB, DUF417 family | Defense mechanisms [V] | 2.03 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.35 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.35 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.35 |
| COG3868 | Alpha-1,4 polygalactosaminidase, glycosyl hydrolase family GH114 | Carbohydrate transport and metabolism [G] | 1.13 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.13 |
| COG2342 | Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) | Carbohydrate transport and metabolism [G] | 1.13 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.90 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.90 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.90 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.90 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.90 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.68 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.68 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.68 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.68 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.68 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.68 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.45 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.45 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.45 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.45 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.23 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.23 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.23 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.23 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.23 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.23 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.23 |
| COG0390 | ABC-type iron transport system FetAB, permease component | Inorganic ion transport and metabolism [P] | 0.23 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.23 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.23 |
| COG3619 | Uncharacterized membrane protein YoaK, UPF0700 family | Function unknown [S] | 0.23 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.23 |
| COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 0.23 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.23 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.23 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.23 |
| COG0289 | 4-hydroxy-tetrahydrodipicolinate reductase | Amino acid transport and metabolism [E] | 0.23 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.23 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.23 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.23 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.23 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.23 |
| COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.23 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.23 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.23 |
| COG1482 | Mannose-6-phosphate isomerase, class I | Carbohydrate transport and metabolism [G] | 0.23 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.23 |
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.23 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.23 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.23 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.23 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.23 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.23 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.23 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.23 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.23 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.23 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.23 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.23 |
| COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.23 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.23 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.23 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.23 |
| COG2390 | DNA-binding transcriptional regulator LsrR, DeoR family | Transcription [K] | 0.23 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.23 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.58 % |
| Unclassified | root | N/A | 12.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000787|JGI11643J11755_11574357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 621 | Open in IMG/M |
| 3300000956|JGI10216J12902_122947763 | Not Available | 639 | Open in IMG/M |
| 3300001867|JGI12627J18819_10066309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1502 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101405980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300002568|C688J35102_118624654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300002568|C688J35102_119744315 | Not Available | 763 | Open in IMG/M |
| 3300002568|C688J35102_120796401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1606 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10350906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 600 | Open in IMG/M |
| 3300004800|Ga0058861_11855068 | Not Available | 639 | Open in IMG/M |
| 3300005093|Ga0062594_102940467 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005181|Ga0066678_10638964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 709 | Open in IMG/M |
| 3300005327|Ga0070658_10466050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1089 | Open in IMG/M |
| 3300005332|Ga0066388_102139541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1008 | Open in IMG/M |
| 3300005338|Ga0068868_101315629 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005341|Ga0070691_10053004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1940 | Open in IMG/M |
| 3300005435|Ga0070714_101065135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 788 | Open in IMG/M |
| 3300005435|Ga0070714_101479886 | Not Available | 663 | Open in IMG/M |
| 3300005437|Ga0070710_10138822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1488 | Open in IMG/M |
| 3300005437|Ga0070710_10969814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 618 | Open in IMG/M |
| 3300005437|Ga0070710_11067314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300005441|Ga0070700_101360336 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005444|Ga0070694_101645439 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005467|Ga0070706_100047868 | All Organisms → cellular organisms → Bacteria | 3946 | Open in IMG/M |
| 3300005467|Ga0070706_100969437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 784 | Open in IMG/M |
| 3300005467|Ga0070706_101897937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
| 3300005468|Ga0070707_100781537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 918 | Open in IMG/M |
| 3300005468|Ga0070707_100869929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 866 | Open in IMG/M |
| 3300005468|Ga0070707_101273787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 701 | Open in IMG/M |
| 3300005468|Ga0070707_101751345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 588 | Open in IMG/M |
| 3300005471|Ga0070698_100218732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1839 | Open in IMG/M |
| 3300005471|Ga0070698_101458087 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005536|Ga0070697_100706378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 890 | Open in IMG/M |
| 3300005542|Ga0070732_10808599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
| 3300005545|Ga0070695_100584185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 875 | Open in IMG/M |
| 3300005548|Ga0070665_100263206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1726 | Open in IMG/M |
| 3300005549|Ga0070704_102271817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
| 3300005559|Ga0066700_10328420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1080 | Open in IMG/M |
| 3300005563|Ga0068855_100656315 | Not Available | 1126 | Open in IMG/M |
| 3300005764|Ga0066903_100119435 | All Organisms → cellular organisms → Bacteria | 3656 | Open in IMG/M |
| 3300005764|Ga0066903_100634354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1863 | Open in IMG/M |
| 3300005764|Ga0066903_108044507 | Not Available | 541 | Open in IMG/M |
| 3300005842|Ga0068858_101053952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 797 | Open in IMG/M |
| 3300006028|Ga0070717_10607272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 992 | Open in IMG/M |
| 3300006028|Ga0070717_10743753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 891 | Open in IMG/M |
| 3300006050|Ga0075028_100287546 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300006059|Ga0075017_100948546 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006173|Ga0070716_100531907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 873 | Open in IMG/M |
| 3300006175|Ga0070712_100679544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 876 | Open in IMG/M |
| 3300006581|Ga0074048_13465876 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300006605|Ga0074057_10043859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300006755|Ga0079222_11486152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 634 | Open in IMG/M |
| 3300006800|Ga0066660_11230402 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300006804|Ga0079221_10812046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 672 | Open in IMG/M |
| 3300006806|Ga0079220_10155629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1267 | Open in IMG/M |
| 3300006806|Ga0079220_10326890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
| 3300006893|Ga0073928_10223207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1459 | Open in IMG/M |
| 3300006903|Ga0075426_10779755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 719 | Open in IMG/M |
| 3300006954|Ga0079219_11262834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 646 | Open in IMG/M |
| 3300006954|Ga0079219_12296406 | Not Available | 521 | Open in IMG/M |
| 3300006954|Ga0079219_12349321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300009038|Ga0099829_11524030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
| 3300009090|Ga0099827_10012738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5524 | Open in IMG/M |
| 3300009090|Ga0099827_10108208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2221 | Open in IMG/M |
| 3300009093|Ga0105240_11249358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 785 | Open in IMG/M |
| 3300009093|Ga0105240_12465467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 538 | Open in IMG/M |
| 3300009094|Ga0111539_12392908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
| 3300009098|Ga0105245_10706505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1042 | Open in IMG/M |
| 3300009137|Ga0066709_101031322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1206 | Open in IMG/M |
| 3300009137|Ga0066709_103430541 | Not Available | 575 | Open in IMG/M |
| 3300009137|Ga0066709_104249298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 522 | Open in IMG/M |
| 3300009147|Ga0114129_12768687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
| 3300009147|Ga0114129_12789944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
| 3300009174|Ga0105241_10970508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. | 793 | Open in IMG/M |
| 3300009176|Ga0105242_11245046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 765 | Open in IMG/M |
| 3300009545|Ga0105237_10971203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 856 | Open in IMG/M |
| 3300009553|Ga0105249_10559432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1195 | Open in IMG/M |
| 3300009698|Ga0116216_10430708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 799 | Open in IMG/M |
| 3300009792|Ga0126374_10286685 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300009826|Ga0123355_11357021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300010040|Ga0126308_10227480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. DSM 110486 | 1206 | Open in IMG/M |
| 3300010043|Ga0126380_10500616 | Not Available | 932 | Open in IMG/M |
| 3300010045|Ga0126311_10050183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2678 | Open in IMG/M |
| 3300010046|Ga0126384_10577767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 980 | Open in IMG/M |
| 3300010048|Ga0126373_10966801 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300010048|Ga0126373_11054427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
| 3300010048|Ga0126373_12434829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
| 3300010048|Ga0126373_12737361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
| 3300010145|Ga0126321_1425696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1103 | Open in IMG/M |
| 3300010154|Ga0127503_10003929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1013 | Open in IMG/M |
| 3300010154|Ga0127503_11113423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 685 | Open in IMG/M |
| 3300010358|Ga0126370_10855066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
| 3300010358|Ga0126370_12298163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
| 3300010359|Ga0126376_10557215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1074 | Open in IMG/M |
| 3300010360|Ga0126372_12692321 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300010361|Ga0126378_10034317 | Not Available | 4578 | Open in IMG/M |
| 3300010361|Ga0126378_10363274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1558 | Open in IMG/M |
| 3300010362|Ga0126377_10544216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1199 | Open in IMG/M |
| 3300010366|Ga0126379_11789634 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300010366|Ga0126379_12720501 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300010366|Ga0126379_13143224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 553 | Open in IMG/M |
| 3300010373|Ga0134128_10116337 | All Organisms → cellular organisms → Bacteria | 3034 | Open in IMG/M |
| 3300010376|Ga0126381_101171881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1110 | Open in IMG/M |
| 3300010376|Ga0126381_101648544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 926 | Open in IMG/M |
| 3300010376|Ga0126381_101684490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus | 916 | Open in IMG/M |
| 3300010376|Ga0126381_101888731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 861 | Open in IMG/M |
| 3300010376|Ga0126381_104740660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
| 3300010379|Ga0136449_103096177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
| 3300010379|Ga0136449_104368157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300010396|Ga0134126_11701719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 692 | Open in IMG/M |
| 3300010396|Ga0134126_12563905 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010398|Ga0126383_12276819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 628 | Open in IMG/M |
| 3300010401|Ga0134121_12869416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
| 3300010867|Ga0126347_1361780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 817 | Open in IMG/M |
| 3300010867|Ga0126347_1555046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 746 | Open in IMG/M |
| 3300010880|Ga0126350_10287626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1757 | Open in IMG/M |
| 3300011000|Ga0138513_100044040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300011107|Ga0151490_1737555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 507 | Open in IMG/M |
| 3300011332|Ga0126317_10810259 | Not Available | 1705 | Open in IMG/M |
| 3300012199|Ga0137383_10283933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1212 | Open in IMG/M |
| 3300012199|Ga0137383_11114317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 571 | Open in IMG/M |
| 3300012200|Ga0137382_10898262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 638 | Open in IMG/M |
| 3300012200|Ga0137382_11238650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
| 3300012204|Ga0137374_10812381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 693 | Open in IMG/M |
| 3300012209|Ga0137379_11359814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 614 | Open in IMG/M |
| 3300012211|Ga0137377_10749365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 910 | Open in IMG/M |
| 3300012212|Ga0150985_105062470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 619 | Open in IMG/M |
| 3300012212|Ga0150985_105831586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 902 | Open in IMG/M |
| 3300012212|Ga0150985_114521061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 538 | Open in IMG/M |
| 3300012349|Ga0137387_10802180 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012354|Ga0137366_10449715 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300012354|Ga0137366_10833845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
| 3300012357|Ga0137384_10144000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1995 | Open in IMG/M |
| 3300012358|Ga0137368_10403737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 897 | Open in IMG/M |
| 3300012359|Ga0137385_11326794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. TRM90224 | 582 | Open in IMG/M |
| 3300012360|Ga0137375_10515742 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300012361|Ga0137360_10911031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 758 | Open in IMG/M |
| 3300012363|Ga0137390_10018341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6423 | Open in IMG/M |
| 3300012363|Ga0137390_10188971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 2046 | Open in IMG/M |
| 3300012363|Ga0137390_11508412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
| 3300012469|Ga0150984_105507322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 750 | Open in IMG/M |
| 3300012896|Ga0157303_10040337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 909 | Open in IMG/M |
| 3300012917|Ga0137395_10453906 | Not Available | 921 | Open in IMG/M |
| 3300012930|Ga0137407_10765815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
| 3300012930|Ga0137407_10773969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
| 3300012957|Ga0164303_11541953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 504 | Open in IMG/M |
| 3300012961|Ga0164302_10231219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1161 | Open in IMG/M |
| 3300012971|Ga0126369_10782967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1035 | Open in IMG/M |
| 3300012971|Ga0126369_11779052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 705 | Open in IMG/M |
| 3300012971|Ga0126369_12054723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300012971|Ga0126369_12467568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 605 | Open in IMG/M |
| 3300012971|Ga0126369_13310199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
| 3300013045|Ga0154016_141449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 984 | Open in IMG/M |
| 3300013104|Ga0157370_11942424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
| 3300013296|Ga0157374_10278881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1650 | Open in IMG/M |
| 3300013306|Ga0163162_10744963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1099 | Open in IMG/M |
| 3300013306|Ga0163162_11236877 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300014157|Ga0134078_10454474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
| 3300014166|Ga0134079_10461148 | Not Available | 605 | Open in IMG/M |
| 3300014166|Ga0134079_10652883 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300015359|Ga0134085_10500434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
| 3300015371|Ga0132258_11182811 | Not Available | 1933 | Open in IMG/M |
| 3300015371|Ga0132258_13684037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
| 3300016294|Ga0182041_12084100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300016319|Ga0182033_10370521 | Not Available | 1203 | Open in IMG/M |
| 3300016319|Ga0182033_10905888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 781 | Open in IMG/M |
| 3300016319|Ga0182033_11631013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
| 3300016319|Ga0182033_12096837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300016357|Ga0182032_10273910 | Not Available | 1322 | Open in IMG/M |
| 3300016371|Ga0182034_10801719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_235 | 806 | Open in IMG/M |
| 3300016387|Ga0182040_10839175 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300016404|Ga0182037_10746460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 841 | Open in IMG/M |
| 3300016422|Ga0182039_10243353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1461 | Open in IMG/M |
| 3300016445|Ga0182038_11145872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 692 | Open in IMG/M |
| 3300016445|Ga0182038_11272736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300016445|Ga0182038_11652908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 577 | Open in IMG/M |
| 3300017657|Ga0134074_1341715 | Not Available | 551 | Open in IMG/M |
| 3300017924|Ga0187820_1181811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 648 | Open in IMG/M |
| 3300017926|Ga0187807_1079208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1026 | Open in IMG/M |
| 3300017928|Ga0187806_1090918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 966 | Open in IMG/M |
| 3300017937|Ga0187809_10231092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
| 3300017942|Ga0187808_10086975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1351 | Open in IMG/M |
| 3300017942|Ga0187808_10303004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 720 | Open in IMG/M |
| 3300017942|Ga0187808_10469962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 580 | Open in IMG/M |
| 3300017973|Ga0187780_10005791 | All Organisms → cellular organisms → Bacteria | 9220 | Open in IMG/M |
| 3300017974|Ga0187777_10414730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 933 | Open in IMG/M |
| 3300017974|Ga0187777_11347708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 525 | Open in IMG/M |
| 3300017997|Ga0184610_1314099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 515 | Open in IMG/M |
| 3300018054|Ga0184621_10104840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1003 | Open in IMG/M |
| 3300018054|Ga0184621_10183396 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300018058|Ga0187766_10008509 | All Organisms → cellular organisms → Bacteria | 5907 | Open in IMG/M |
| 3300018058|Ga0187766_11431677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 508 | Open in IMG/M |
| 3300018060|Ga0187765_10447460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 807 | Open in IMG/M |
| 3300018061|Ga0184619_10148074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1071 | Open in IMG/M |
| 3300018076|Ga0184609_10250462 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300018081|Ga0184625_10471628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 640 | Open in IMG/M |
| 3300018081|Ga0184625_10606297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
| 3300018089|Ga0187774_11097253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
| 3300018429|Ga0190272_12719881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
| 3300018432|Ga0190275_11458890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300018433|Ga0066667_11024881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 712 | Open in IMG/M |
| 3300018920|Ga0190273_10135107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1446 | Open in IMG/M |
| 3300019356|Ga0173481_10254296 | Not Available | 793 | Open in IMG/M |
| 3300019867|Ga0193704_1008424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2060 | Open in IMG/M |
| 3300020020|Ga0193738_1100402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 827 | Open in IMG/M |
| 3300020070|Ga0206356_10778600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 642 | Open in IMG/M |
| 3300020070|Ga0206356_11067460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
| 3300020081|Ga0206354_10066115 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300020082|Ga0206353_10879077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 893 | Open in IMG/M |
| 3300020580|Ga0210403_10749921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 779 | Open in IMG/M |
| 3300020581|Ga0210399_10173511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1788 | Open in IMG/M |
| 3300020581|Ga0210399_11134526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 624 | Open in IMG/M |
| 3300020581|Ga0210399_11353818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 558 | Open in IMG/M |
| 3300020583|Ga0210401_10453313 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300021078|Ga0210381_10033564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1458 | Open in IMG/M |
| 3300021178|Ga0210408_10912912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 683 | Open in IMG/M |
| 3300021402|Ga0210385_10878358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 688 | Open in IMG/M |
| 3300021404|Ga0210389_10339886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1178 | Open in IMG/M |
| 3300021407|Ga0210383_11121518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 663 | Open in IMG/M |
| 3300021477|Ga0210398_10092719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2452 | Open in IMG/M |
| 3300021478|Ga0210402_10110405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2478 | Open in IMG/M |
| 3300021478|Ga0210402_10476303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1159 | Open in IMG/M |
| 3300021559|Ga0210409_10527598 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300021559|Ga0210409_10999184 | Not Available | 711 | Open in IMG/M |
| 3300022467|Ga0224712_10052462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1593 | Open in IMG/M |
| 3300022756|Ga0222622_10156129 | Not Available | 1476 | Open in IMG/M |
| 3300022756|Ga0222622_11148744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 571 | Open in IMG/M |
| 3300022901|Ga0247788_1072560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 658 | Open in IMG/M |
| 3300024325|Ga0247678_1071182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
| 3300025910|Ga0207684_10776712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 811 | Open in IMG/M |
| 3300025910|Ga0207684_10928692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 730 | Open in IMG/M |
| 3300025910|Ga0207684_11539791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
| 3300025914|Ga0207671_10851128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300025915|Ga0207693_10647997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 821 | Open in IMG/M |
| 3300025916|Ga0207663_10629584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 845 | Open in IMG/M |
| 3300025916|Ga0207663_11738135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300025921|Ga0207652_10351627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Iso899 | 1330 | Open in IMG/M |
| 3300025921|Ga0207652_10453414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1156 | Open in IMG/M |
| 3300025921|Ga0207652_11646538 | Not Available | 546 | Open in IMG/M |
| 3300025922|Ga0207646_10652688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 942 | Open in IMG/M |
| 3300025922|Ga0207646_10824963 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300025923|Ga0207681_11024624 | Not Available | 693 | Open in IMG/M |
| 3300025927|Ga0207687_10170392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1679 | Open in IMG/M |
| 3300025933|Ga0207706_11079120 | Not Available | 672 | Open in IMG/M |
| 3300025939|Ga0207665_10326399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1153 | Open in IMG/M |
| 3300025939|Ga0207665_10983607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
| 3300025941|Ga0207711_10548580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1078 | Open in IMG/M |
| 3300025942|Ga0207689_10800266 | Not Available | 796 | Open in IMG/M |
| 3300025944|Ga0207661_11901612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300025949|Ga0207667_10394254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1410 | Open in IMG/M |
| 3300025961|Ga0207712_11190525 | Not Available | 680 | Open in IMG/M |
| 3300025981|Ga0207640_11467150 | Not Available | 612 | Open in IMG/M |
| 3300026023|Ga0207677_10396049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1170 | Open in IMG/M |
| 3300026067|Ga0207678_10890167 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300026078|Ga0207702_11810725 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300026089|Ga0207648_10797256 | Not Available | 879 | Open in IMG/M |
| 3300026551|Ga0209648_10638883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
| 3300027117|Ga0209732_1087995 | Not Available | 541 | Open in IMG/M |
| 3300027528|Ga0208985_1041805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 893 | Open in IMG/M |
| 3300027725|Ga0209178_1220148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
| 3300027727|Ga0209328_10156806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 691 | Open in IMG/M |
| 3300027855|Ga0209693_10216353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 942 | Open in IMG/M |
| 3300027875|Ga0209283_10090824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus carbonis | 1989 | Open in IMG/M |
| 3300027882|Ga0209590_10039154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2569 | Open in IMG/M |
| 3300027903|Ga0209488_10064305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2713 | Open in IMG/M |
| 3300027908|Ga0209006_10105463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2497 | Open in IMG/M |
| 3300028047|Ga0209526_10781877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300028072|Ga0247675_1016223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1061 | Open in IMG/M |
| 3300028380|Ga0268265_12065880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 577 | Open in IMG/M |
| 3300028536|Ga0137415_10185583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1904 | Open in IMG/M |
| 3300028587|Ga0247828_10845536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
| 3300028596|Ga0247821_10168700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
| 3300028597|Ga0247820_10396252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 923 | Open in IMG/M |
| 3300028717|Ga0307298_10001617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5205 | Open in IMG/M |
| 3300028722|Ga0307319_10297865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
| 3300028744|Ga0307318_10270428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 593 | Open in IMG/M |
| 3300028768|Ga0307280_10055214 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300028791|Ga0307290_10029161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1953 | Open in IMG/M |
| 3300028791|Ga0307290_10032390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1858 | Open in IMG/M |
| 3300028792|Ga0307504_10401096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
| 3300028793|Ga0307299_10385558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 525 | Open in IMG/M |
| 3300028802|Ga0307503_10332444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis | 773 | Open in IMG/M |
| 3300028807|Ga0307305_10531394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 526 | Open in IMG/M |
| 3300028810|Ga0307294_10093061 | Not Available | 945 | Open in IMG/M |
| 3300028814|Ga0307302_10045880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2030 | Open in IMG/M |
| 3300028814|Ga0307302_10654079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
| 3300028819|Ga0307296_10200181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1084 | Open in IMG/M |
| 3300028819|Ga0307296_10231578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium innocens | 1004 | Open in IMG/M |
| 3300028824|Ga0307310_10079717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1423 | Open in IMG/M |
| 3300028875|Ga0307289_10011136 | All Organisms → cellular organisms → Bacteria | 3446 | Open in IMG/M |
| 3300028880|Ga0307300_10210979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 632 | Open in IMG/M |
| 3300028885|Ga0307304_10013962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2601 | Open in IMG/M |
| 3300028885|Ga0307304_10572065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
| 3300030496|Ga0268240_10118565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 632 | Open in IMG/M |
| 3300030993|Ga0308190_1033565 | Not Available | 918 | Open in IMG/M |
| 3300031057|Ga0170834_106129154 | Not Available | 1162 | Open in IMG/M |
| 3300031058|Ga0308189_10133220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 832 | Open in IMG/M |
| 3300031082|Ga0308192_1011311 | Not Available | 1058 | Open in IMG/M |
| 3300031096|Ga0308193_1004098 | Not Available | 1452 | Open in IMG/M |
| 3300031123|Ga0308195_1004890 | Not Available | 1325 | Open in IMG/M |
| 3300031231|Ga0170824_105507969 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031544|Ga0318534_10027789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3064 | Open in IMG/M |
| 3300031544|Ga0318534_10170187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1259 | Open in IMG/M |
| 3300031544|Ga0318534_10205909 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300031544|Ga0318534_10399444 | Not Available | 789 | Open in IMG/M |
| 3300031564|Ga0318573_10477058 | Not Available | 671 | Open in IMG/M |
| 3300031572|Ga0318515_10110578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1447 | Open in IMG/M |
| 3300031572|Ga0318515_10495086 | Not Available | 652 | Open in IMG/M |
| 3300031573|Ga0310915_10645088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 749 | Open in IMG/M |
| 3300031640|Ga0318555_10206157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1060 | Open in IMG/M |
| 3300031640|Ga0318555_10416476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
| 3300031640|Ga0318555_10465361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 685 | Open in IMG/M |
| 3300031640|Ga0318555_10566570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
| 3300031668|Ga0318542_10100568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1395 | Open in IMG/M |
| 3300031668|Ga0318542_10106738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1358 | Open in IMG/M |
| 3300031668|Ga0318542_10265334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 875 | Open in IMG/M |
| 3300031668|Ga0318542_10655543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
| 3300031679|Ga0318561_10421156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_235 | 734 | Open in IMG/M |
| 3300031681|Ga0318572_10601296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 655 | Open in IMG/M |
| 3300031681|Ga0318572_10876881 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031681|Ga0318572_10908391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
| 3300031708|Ga0310686_110836656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 676 | Open in IMG/M |
| 3300031708|Ga0310686_111733648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
| 3300031719|Ga0306917_11576972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300031720|Ga0307469_12138630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
| 3300031723|Ga0318493_10134214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1270 | Open in IMG/M |
| 3300031723|Ga0318493_10365241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300031736|Ga0318501_10026100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 2528 | Open in IMG/M |
| 3300031736|Ga0318501_10367575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
| 3300031736|Ga0318501_10372697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 769 | Open in IMG/M |
| 3300031744|Ga0306918_11160297 | Not Available | 597 | Open in IMG/M |
| 3300031744|Ga0306918_11461344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
| 3300031744|Ga0306918_11567158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300031747|Ga0318502_10186911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1195 | Open in IMG/M |
| 3300031748|Ga0318492_10202062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
| 3300031748|Ga0318492_10613137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
| 3300031751|Ga0318494_10765384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 565 | Open in IMG/M |
| 3300031764|Ga0318535_10125563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1136 | Open in IMG/M |
| 3300031764|Ga0318535_10202874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 887 | Open in IMG/M |
| 3300031765|Ga0318554_10134339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1401 | Open in IMG/M |
| 3300031765|Ga0318554_10576429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300031765|Ga0318554_10617582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300031765|Ga0318554_10807328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
| 3300031770|Ga0318521_10263090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1009 | Open in IMG/M |
| 3300031770|Ga0318521_10486014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 741 | Open in IMG/M |
| 3300031771|Ga0318546_10319857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1076 | Open in IMG/M |
| 3300031778|Ga0318498_10221188 | Not Available | 856 | Open in IMG/M |
| 3300031779|Ga0318566_10029058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2525 | Open in IMG/M |
| 3300031779|Ga0318566_10141446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1191 | Open in IMG/M |
| 3300031779|Ga0318566_10330366 | Not Available | 753 | Open in IMG/M |
| 3300031779|Ga0318566_10354174 | Not Available | 724 | Open in IMG/M |
| 3300031781|Ga0318547_10861864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300031782|Ga0318552_10030264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2478 | Open in IMG/M |
| 3300031794|Ga0318503_10236281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300031795|Ga0318557_10408084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
| 3300031796|Ga0318576_10238107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 858 | Open in IMG/M |
| 3300031799|Ga0318565_10153875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1115 | Open in IMG/M |
| 3300031799|Ga0318565_10395990 | Not Available | 670 | Open in IMG/M |
| 3300031799|Ga0318565_10508239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
| 3300031799|Ga0318565_10528295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300031799|Ga0318565_10558114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
| 3300031805|Ga0318497_10027896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2800 | Open in IMG/M |
| 3300031805|Ga0318497_10779207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
| 3300031805|Ga0318497_10784230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300031819|Ga0318568_10094478 | Not Available | 1784 | Open in IMG/M |
| 3300031819|Ga0318568_10263042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1069 | Open in IMG/M |
| 3300031819|Ga0318568_10518821 | Not Available | 743 | Open in IMG/M |
| 3300031819|Ga0318568_10651926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 655 | Open in IMG/M |
| 3300031819|Ga0318568_10682519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 639 | Open in IMG/M |
| 3300031819|Ga0318568_10780829 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031821|Ga0318567_10058913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2003 | Open in IMG/M |
| 3300031823|Ga0307478_10741995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
| 3300031824|Ga0307413_11591520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 580 | Open in IMG/M |
| 3300031824|Ga0307413_12046272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300031831|Ga0318564_10168195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus ruber | 978 | Open in IMG/M |
| 3300031831|Ga0318564_10193830 | Not Available | 905 | Open in IMG/M |
| 3300031831|Ga0318564_10506100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300031833|Ga0310917_10727304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300031835|Ga0318517_10452533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 579 | Open in IMG/M |
| 3300031847|Ga0310907_10777549 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031852|Ga0307410_10563141 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300031860|Ga0318495_10050827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1836 | Open in IMG/M |
| 3300031860|Ga0318495_10103045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1284 | Open in IMG/M |
| 3300031880|Ga0318544_10115730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1017 | Open in IMG/M |
| 3300031880|Ga0318544_10378322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300031896|Ga0318551_10669939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 600 | Open in IMG/M |
| 3300031897|Ga0318520_10438827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_235 | 801 | Open in IMG/M |
| 3300031910|Ga0306923_10542920 | Not Available | 1311 | Open in IMG/M |
| 3300031910|Ga0306923_12074582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300031912|Ga0306921_10354086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1716 | Open in IMG/M |
| 3300031912|Ga0306921_11167244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300031912|Ga0306921_11513483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 733 | Open in IMG/M |
| 3300031912|Ga0306921_12500625 | Not Available | 536 | Open in IMG/M |
| 3300031941|Ga0310912_10454277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 999 | Open in IMG/M |
| 3300031941|Ga0310912_10778156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
| 3300031946|Ga0310910_11402780 | Not Available | 538 | Open in IMG/M |
| 3300031947|Ga0310909_10186519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1719 | Open in IMG/M |
| 3300031947|Ga0310909_10742926 | Not Available | 813 | Open in IMG/M |
| 3300031947|Ga0310909_11194556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
| 3300031954|Ga0306926_10005967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13034 | Open in IMG/M |
| 3300031954|Ga0306926_12100229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
| 3300031959|Ga0318530_10381279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
| 3300031981|Ga0318531_10226523 | Not Available | 843 | Open in IMG/M |
| 3300032001|Ga0306922_11603907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
| 3300032008|Ga0318562_10874172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300032009|Ga0318563_10739681 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300032010|Ga0318569_10212393 | Not Available | 897 | Open in IMG/M |
| 3300032013|Ga0310906_10776042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 675 | Open in IMG/M |
| 3300032041|Ga0318549_10504982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
| 3300032041|Ga0318549_10532008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
| 3300032042|Ga0318545_10191179 | Not Available | 732 | Open in IMG/M |
| 3300032044|Ga0318558_10225249 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300032052|Ga0318506_10043705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1782 | Open in IMG/M |
| 3300032052|Ga0318506_10559485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
| 3300032055|Ga0318575_10038239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2145 | Open in IMG/M |
| 3300032055|Ga0318575_10475334 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300032060|Ga0318505_10417420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 634 | Open in IMG/M |
| 3300032063|Ga0318504_10189032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 959 | Open in IMG/M |
| 3300032063|Ga0318504_10522192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
| 3300032066|Ga0318514_10288055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 867 | Open in IMG/M |
| 3300032067|Ga0318524_10143022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1206 | Open in IMG/M |
| 3300032067|Ga0318524_10169892 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300032067|Ga0318524_10300029 | Not Available | 831 | Open in IMG/M |
| 3300032067|Ga0318524_10610668 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300032076|Ga0306924_11169612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 834 | Open in IMG/M |
| 3300032076|Ga0306924_11647236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 674 | Open in IMG/M |
| 3300032089|Ga0318525_10202929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1019 | Open in IMG/M |
| 3300032089|Ga0318525_10589080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 567 | Open in IMG/M |
| 3300032094|Ga0318540_10641818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300032160|Ga0311301_12083116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300032180|Ga0307471_101887911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300032261|Ga0306920_100129826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3749 | Open in IMG/M |
| 3300032261|Ga0306920_103243105 | Not Available | 608 | Open in IMG/M |
| 3300032770|Ga0335085_10271714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2025 | Open in IMG/M |
| 3300032783|Ga0335079_11947986 | Not Available | 567 | Open in IMG/M |
| 3300032828|Ga0335080_10888458 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300032892|Ga0335081_10872688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1065 | Open in IMG/M |
| 3300032892|Ga0335081_11528609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces gobiensis | 737 | Open in IMG/M |
| 3300032895|Ga0335074_10048350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5869 | Open in IMG/M |
| 3300032895|Ga0335074_10352848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1634 | Open in IMG/M |
| 3300033134|Ga0335073_10817915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 996 | Open in IMG/M |
| 3300033158|Ga0335077_10745232 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300033289|Ga0310914_10502579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1097 | Open in IMG/M |
| 3300033289|Ga0310914_11486457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.13% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.22% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.03% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.58% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.13% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.13% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.90% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.45% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.45% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.23% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.23% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.23% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.23% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.23% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.23% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.23% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.23% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J11755_115743571 | 3300000787 | Soil | VADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAS* |
| JGI10216J12902_1229477632 | 3300000956 | Soil | DKGFVVSVGTRRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAQ* |
| JGI12627J18819_100663093 | 3300001867 | Forest Soil | GVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR* |
| JGIcombinedJ26739_1014059802 | 3300002245 | Forest Soil | AGITSGGRMAHLLKDAIEWEYRQSVRHLRGWDPAGR* |
| C688J35102_1186246542 | 3300002568 | Soil | THRGVAEIAGITTGGRLAHLLKDAIEGEYRQSVKHLRGWDPVAR* |
| C688J35102_1197443151 | 3300002568 | Soil | VSVGTRRGVADVAGITAGGRLAHLLKDVIEWEYRQSVKHLRGWDPVAG* |
| C688J35102_1207964011 | 3300002568 | Soil | HDKGFVVSVGQRRGVADVAGITSGGRLAHLLKDVIEWEYRQSVRHLRGWDPVPL* |
| JGIcombinedJ51221_103509062 | 3300003505 | Forest Soil | KGFVVSVGTRRGVADIAGITAGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAL* |
| Ga0058861_118550682 | 3300004800 | Host-Associated | RRGVADVAGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG* |
| Ga0062594_1029404671 | 3300005093 | Soil | HDKGFVVSVGTSRGVADVAGVTTGGRLAHLLKDAIEWQYRQSVKHLRGWDPMAR* |
| Ga0066678_106389642 | 3300005181 | Soil | TRRGVADIAGITTGGRLAHTLKDAIEWEYRQSVKHLRGWDPVAI* |
| Ga0070658_104660501 | 3300005327 | Corn Rhizosphere | RGVADVAGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG* |
| Ga0066388_1021395412 | 3300005332 | Tropical Forest Soil | GTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAG* |
| Ga0068868_1013156292 | 3300005338 | Miscanthus Rhizosphere | FHDKGFVVSVGTRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVRHLRGWDPIAR* |
| Ga0070691_100530041 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP* |
| Ga0070714_1010651351 | 3300005435 | Agricultural Soil | FVVSVGTRRGVADIAGLTTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIPG* |
| Ga0070714_1014798861 | 3300005435 | Agricultural Soil | VSVGAERGVADVAGRTIGGRLAGVLKEAIEWEYRQSVKHLRGWSPL* |
| Ga0070710_101388221 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | FVVSVGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV* |
| Ga0070710_109698142 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP* |
| Ga0070710_110673141 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ADIASITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV* |
| Ga0070700_1013603361 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | GFVVSVGARRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKYLRGWDPLAV* |
| Ga0070694_1016454392 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | DKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP* |
| Ga0070706_1000478681 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DKGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAL* |
| Ga0070706_1009694373 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGVADIAGITTGGHLAHLLKDAIEWEYRQSVTHLRGWDPIAL* |
| Ga0070706_1018979371 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DKGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR* |
| Ga0070707_1007815371 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR* |
| Ga0070707_1008699292 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FHDKGFVVSVGTSRGVADIAGITTGGRAARLLKDAIEWEYRQSVRHLRGWDPVAG* |
| Ga0070707_1012737871 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0070707_1017513452 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RGVADIAGITTGGHLAHLLKDAIEWEYRQSVTHLRGWDPIAL* |
| Ga0070698_1002187325 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | KGFVVSVGTRRGVADIAGVTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0070698_1014580871 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAL* |
| Ga0070697_1007063781 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAM* |
| Ga0070732_108085992 | 3300005542 | Surface Soil | SVGTRRGVADIAGITSGGHLAHLLKDAIEWEYRQSVTHLRGWDPIAL* |
| Ga0070695_1005841851 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TRRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG* |
| Ga0070665_1002632061 | 3300005548 | Switchgrass Rhizosphere | GITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG* |
| Ga0070704_1022718171 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL* |
| Ga0066700_103284201 | 3300005559 | Soil | RGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIPG* |
| Ga0068855_1006563151 | 3300005563 | Corn Rhizosphere | RRGVADIAGITSGGRLAHVLKDVIEWEYRQSVTHLRGWDPLAR* |
| Ga0066903_1001194351 | 3300005764 | Tropical Forest Soil | FVVSVGTSRGVADIAGLTTGGHLAHLLKDAIEWEYRQTVQHLRGWDPIAL* |
| Ga0066903_1006343541 | 3300005764 | Tropical Forest Soil | ITSGGKAAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0066903_1080445071 | 3300005764 | Tropical Forest Soil | VVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0068858_1010539521 | 3300005842 | Switchgrass Rhizosphere | RDKGFVVSVGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV* |
| Ga0070717_106072722 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0070717_107437532 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPAAW* |
| Ga0075028_1002875461 | 3300006050 | Watersheds | FVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAL* |
| Ga0075017_1009485462 | 3300006059 | Watersheds | TRRGVADIAGITTGGHLAHLLKDTIEWEYRQSVKHLRGWDPVAR* |
| Ga0070716_1005319073 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP* |
| Ga0070712_1006795443 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPLPG* |
| Ga0074048_134658762 | 3300006581 | Soil | KGFVVSVGTRRGVADIAGITSGGRLAHLLKDVIEWEYRQSVTHLRGWDPVAR* |
| Ga0074057_100438591 | 3300006605 | Soil | GTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL* |
| Ga0079222_114861521 | 3300006755 | Agricultural Soil | ITTSGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR* |
| Ga0066660_112304022 | 3300006800 | Soil | GVTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0079221_108120463 | 3300006804 | Agricultural Soil | GITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL* |
| Ga0079220_101556291 | 3300006806 | Agricultural Soil | NRRGVADVAGVTSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG* |
| Ga0079220_103268901 | 3300006806 | Agricultural Soil | NRRGVADVAGVTSGGRIAHLLKDAIEWEYRQSVKHLRGWDPAA* |
| Ga0073928_102232071 | 3300006893 | Iron-Sulfur Acid Spring | GITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLPG* |
| Ga0075426_107797551 | 3300006903 | Populus Rhizosphere | VSVGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV* |
| Ga0079219_112628342 | 3300006954 | Agricultural Soil | VVSVGTRRGVADVVGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAM* |
| Ga0079219_122964062 | 3300006954 | Agricultural Soil | VVGITSGGRMAHLLKDAIEWEYRQSVKHLRGWDPVG* |
| Ga0079219_123493211 | 3300006954 | Agricultural Soil | AGLTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV* |
| Ga0099829_115240302 | 3300009038 | Vadose Zone Soil | DIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL* |
| Ga0099827_1001273810 | 3300009090 | Vadose Zone Soil | TRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAR* |
| Ga0099827_101082082 | 3300009090 | Vadose Zone Soil | TRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL* |
| Ga0105240_112493581 | 3300009093 | Corn Rhizosphere | IAGITSGGRLAHLLKDAIEWEYRESVRHLRGRDPVAV* |
| Ga0105240_124654671 | 3300009093 | Corn Rhizosphere | VVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAM* |
| Ga0111539_123929081 | 3300009094 | Populus Rhizosphere | ARRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV* |
| Ga0105245_107065051 | 3300009098 | Miscanthus Rhizosphere | IAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG* |
| Ga0066709_1010313221 | 3300009137 | Grasslands Soil | KGFVVSVGTRRGVADIAGITSGGRLAHLLKDGIEWEYRQSVTHLRGWDPLAL* |
| Ga0066709_1034305412 | 3300009137 | Grasslands Soil | SIGDRAGVAELAGITIGGRLAHGLKDAIEWEYRQSVKHLHGFAAV* |
| Ga0066709_1042492982 | 3300009137 | Grasslands Soil | DIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPVAR* |
| Ga0114129_127686872 | 3300009147 | Populus Rhizosphere | DIAGITSGGQLAHLLKDAIEWEYRQSVSHLRGWDPIAR* |
| Ga0114129_127899441 | 3300009147 | Populus Rhizosphere | RGVADIAGITGGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL* |
| Ga0105241_109705083 | 3300009174 | Corn Rhizosphere | VSVGNRRGVADVAGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG* |
| Ga0105242_112450461 | 3300009176 | Miscanthus Rhizosphere | VVSVGTRRGVADIAGITTGGRLAHGLKDAIEWENRQSVKHLRGWDPG* |
| Ga0105237_109712031 | 3300009545 | Corn Rhizosphere | RRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV* |
| Ga0105249_105594323 | 3300009553 | Switchgrass Rhizosphere | GVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPG* |
| Ga0116216_104307082 | 3300009698 | Peatlands Soil | DIAGITSAGRLAHLLKDAIEWEYRQSVSHLRGWDPVAL* |
| Ga0126374_102866852 | 3300009792 | Tropical Forest Soil | FVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR* |
| Ga0123355_113570213 | 3300009826 | Termite Gut | FVVSVGPSRGVADIAHITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0126308_102274804 | 3300010040 | Serpentine Soil | FHDKGFVVSVGARRGVADIAGIASGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAR* |
| Ga0126380_105006162 | 3300010043 | Tropical Forest Soil | GTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR* |
| Ga0126311_100501834 | 3300010045 | Serpentine Soil | SVGARRGVADIAGITGGGQLAHLLKDAIEWEYHQSVRYLRGWDPVAR* |
| Ga0126384_105777671 | 3300010046 | Tropical Forest Soil | VADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIAG* |
| Ga0126373_109668011 | 3300010048 | Tropical Forest Soil | ADIAGITTGGRAAHLLKDAIEWEYRQSVKHLRGWDL* |
| Ga0126373_110544271 | 3300010048 | Tropical Forest Soil | VSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0126373_124348292 | 3300010048 | Tropical Forest Soil | VADIAGITTSGHLAHLLKDAIEWEYRQSVKHLRGWDPLPG* |
| Ga0126373_127373611 | 3300010048 | Tropical Forest Soil | RRGVADVAGITTGGRLAHLLKDAIEFEYRQSVRHLRGWDPVAV* |
| Ga0126321_14256961 | 3300010145 | Soil | SVGPRRGVAALAGITTGGRLAHVLKDAVEWEYRQSVQRLRGWDPLAV* |
| Ga0127503_100039293 | 3300010154 | Soil | SVGTHRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG* |
| Ga0127503_111134231 | 3300010154 | Soil | RRGVADIAGITTGGRLAHGLKDAVEWEYRQSVKHLRGWDPG* |
| Ga0126370_108550661 | 3300010358 | Tropical Forest Soil | KGFVVSVGTRRGVADIAGITTGGHVAHLLKDAIEWEYRESVKHLRGWDPISQ* |
| Ga0126370_122981632 | 3300010358 | Tropical Forest Soil | GVADIAGLTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV* |
| Ga0126376_105572152 | 3300010359 | Tropical Forest Soil | ADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR* |
| Ga0126372_126923211 | 3300010360 | Tropical Forest Soil | GITTGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG* |
| Ga0126378_100343174 | 3300010361 | Tropical Forest Soil | HDKGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAR* |
| Ga0126378_103632743 | 3300010361 | Tropical Forest Soil | GDIAGITTGGRAAHLLKDAIEWEYRQAVRHLRGWDPIPG* |
| Ga0126377_105442161 | 3300010362 | Tropical Forest Soil | RCGVADIAHITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPIA* |
| Ga0126379_117896341 | 3300010366 | Tropical Forest Soil | ADIAGITTGGRMAHLLKDAIEWEYRQSVKHLRGWDPVAR* |
| Ga0126379_127205012 | 3300010366 | Tropical Forest Soil | FFFSVGTSRGVAEIAGLTTGWLLSNLLKDAIEWEYRQSVKHLRGWDPIAR* |
| Ga0126379_131432242 | 3300010366 | Tropical Forest Soil | RRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV* |
| Ga0134128_101163373 | 3300010373 | Terrestrial Soil | GFVVSVGTRRGVAGIAGITSGGRLAHLLKDAIEWEYRESVRHLRGRDPVAV* |
| Ga0126381_1011718811 | 3300010376 | Tropical Forest Soil | GVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0126381_1016485441 | 3300010376 | Tropical Forest Soil | IAGITTGGRLAHLLKDAIEWEYRQCVRHLRGWDPVAR* |
| Ga0126381_1016844902 | 3300010376 | Tropical Forest Soil | FVVSVGTRRGVADIAGVTTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG* |
| Ga0126381_1018887311 | 3300010376 | Tropical Forest Soil | KGFVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPLPG* |
| Ga0126381_1047406602 | 3300010376 | Tropical Forest Soil | DIAGVTTGGKAAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0136449_1030961772 | 3300010379 | Peatlands Soil | FVVSVGNRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR* |
| Ga0136449_1043681571 | 3300010379 | Peatlands Soil | KGFVVSIGPRRGVADVAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAM* |
| Ga0134126_117017191 | 3300010396 | Terrestrial Soil | RLAHVLKDAIEWEYRQSVRHLRGWDPVGPLSRPR* |
| Ga0134126_125639052 | 3300010396 | Terrestrial Soil | RRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKYLRGWDPLAV* |
| Ga0126383_122768192 | 3300010398 | Tropical Forest Soil | VVSVGTRRGVADIAGITTGGRAAHLLKDAIEWEYRQSVKHLRGWDPLPG* |
| Ga0134121_128694162 | 3300010401 | Terrestrial Soil | ADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP* |
| Ga0126347_13617802 | 3300010867 | Boreal Forest Soil | FVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR* |
| Ga0126347_15550461 | 3300010867 | Boreal Forest Soil | DVAGITSGGRLAHLLKDAIEWEYRQSVKHLRGWDL* |
| Ga0126350_102876262 | 3300010880 | Boreal Forest Soil | HRGVADIASITSGGRLAHLLKDAIEWEYRQSVSHLRGWDPVAR* |
| Ga0138513_1000440401 | 3300011000 | Soil | RRGVADIAGITTGGRLAHLLKDAIEWEYRESVKHLRGWDPLAV* |
| Ga0151490_17375551 | 3300011107 | Soil | GVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL* |
| Ga0126317_108102591 | 3300011332 | Soil | VVSVGTRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVSHLRGWDPIAR* |
| Ga0137383_102839331 | 3300012199 | Vadose Zone Soil | TRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPI* |
| Ga0137383_111143172 | 3300012199 | Vadose Zone Soil | VVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRKSVRHLRGWDPVAR* |
| Ga0137382_108982621 | 3300012200 | Vadose Zone Soil | VGTSRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAQ* |
| Ga0137382_112386501 | 3300012200 | Vadose Zone Soil | GITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIAR* |
| Ga0137374_108123811 | 3300012204 | Vadose Zone Soil | HNHGVGGAVGAEHGEADDPGFTTGGRLAHVLKDAIEWEYRQSVKHLRGWDPLAM* |
| Ga0137379_113598141 | 3300012209 | Vadose Zone Soil | RRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGSDPVAV* |
| Ga0137377_107493652 | 3300012211 | Vadose Zone Soil | VGTRRGVADIAGITTGGHLAHLLKDTIEWEYRQSVKHLRGWDPLPG* |
| Ga0150985_1050624701 | 3300012212 | Avena Fatua Rhizosphere | AGITTGGRLAHLLKYAIEWEYRQSVRHLRGWDPFAR* |
| Ga0150985_1058315861 | 3300012212 | Avena Fatua Rhizosphere | ITTGGRLAHLLKDAIEGEYRQSVKHLRGWDPVAR* |
| Ga0150985_1145210612 | 3300012212 | Avena Fatua Rhizosphere | ITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLAV* |
| Ga0137387_108021802 | 3300012349 | Vadose Zone Soil | VVSVGRGRAVADIADITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0137366_104497151 | 3300012354 | Vadose Zone Soil | KGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0137366_108338451 | 3300012354 | Vadose Zone Soil | FVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAR* |
| Ga0137384_101440006 | 3300012357 | Vadose Zone Soil | VSVGTSRGVADIAGITTGGHLAHLLRDAIEWEYRQSVKHLRGWDPIPG* |
| Ga0137368_104037372 | 3300012358 | Vadose Zone Soil | VTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIAR* |
| Ga0137385_113267942 | 3300012359 | Vadose Zone Soil | VADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0137375_105157422 | 3300012360 | Vadose Zone Soil | DKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0137360_109110312 | 3300012361 | Vadose Zone Soil | RGVADIAGITTGGRLAHLLKDAIEWECRECVRHLRGWDPVAR* |
| Ga0137390_1001834112 | 3300012363 | Vadose Zone Soil | RRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL* |
| Ga0137390_101889713 | 3300012363 | Vadose Zone Soil | IAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDSVAR* |
| Ga0137390_115084121 | 3300012363 | Vadose Zone Soil | FVISIGDRAGAADVAGITLGGRLAHGLKDAIEWEYRQSVKYLRGFAAV* |
| Ga0150984_1055073222 | 3300012469 | Avena Fatua Rhizosphere | GITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR* |
| Ga0157303_100403371 | 3300012896 | Soil | IAGITSGGRLTHLLKDLIEWEYRQSVTHLRGWDPLAS* |
| Ga0137395_104539062 | 3300012917 | Vadose Zone Soil | VVSVGTRRGVADIAGITSGGHLAHLLKDAIEWEYRQSVTHLRGWDPVAL* |
| Ga0137407_107658153 | 3300012930 | Vadose Zone Soil | SVGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV* |
| Ga0137407_107739691 | 3300012930 | Vadose Zone Soil | DKGFVVSVGTRRGVADIAGIIAGGRLAHLLKDAIEWEYRQSVKHLRGWDPV* |
| Ga0164303_115419531 | 3300012957 | Soil | RRGVADIAGITGGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL* |
| Ga0164302_102312191 | 3300012961 | Soil | GFVVSVGTRRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG* |
| Ga0126369_107829671 | 3300012971 | Tropical Forest Soil | VSVGTSRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0126369_117790522 | 3300012971 | Tropical Forest Soil | SVGTRRGDADIAGITTGGHVAHLLKDAIEWEYRESVKHLRGWDPISQ* |
| Ga0126369_120547231 | 3300012971 | Tropical Forest Soil | KGFVVSVGPRRGVADIAGITSGGKAAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0126369_124675681 | 3300012971 | Tropical Forest Soil | LHDKGIVVSVGPTRGVAEVLGHPFAGRLAHALKDAIEWEYRASVQHLRGWSPV* |
| Ga0126369_133101991 | 3300012971 | Tropical Forest Soil | VGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0154016_1414493 | 3300013045 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSVGTRRGVADIAGITTGGRLAHVLKDAIEWEYRQSVRHLRGWDPVGPLSRPR* |
| Ga0157370_119424241 | 3300013104 | Corn Rhizosphere | HDKGFVVSVGTRRGVAGITSGGRLAHLLKDAIEWEYRESVRHLRGRDP* |
| Ga0157374_102788811 | 3300013296 | Miscanthus Rhizosphere | LREHGFGVSAAPRRGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP* |
| Ga0163162_107449631 | 3300013306 | Switchgrass Rhizosphere | VVSVGTRRVVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG* |
| Ga0163162_112368771 | 3300013306 | Switchgrass Rhizosphere | RGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAQ* |
| Ga0134078_104544742 | 3300014157 | Grasslands Soil | ITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0134079_104611482 | 3300014166 | Grasslands Soil | SVGTRRGVADIAGITTGGRLAHRLKDAIEWEYRQSVKHLRGWDPV* |
| Ga0134079_106528832 | 3300014166 | Grasslands Soil | VGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPVAR* |
| Ga0134085_105004342 | 3300015359 | Grasslands Soil | GVADVAGVTAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR* |
| Ga0132258_111828114 | 3300015371 | Arabidopsis Rhizosphere | GFVVSVGTRRGVADIAGISSGGRLAHLLKDIIEWEERQSVTHLRGWDPLAR* |
| Ga0132258_136840371 | 3300015371 | Arabidopsis Rhizosphere | IAGVTTGGHVAHLLKDAIEWEYRQSVKHLRGWDPLPG* |
| Ga0182041_120841001 | 3300016294 | Soil | HDKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0182033_103705212 | 3300016319 | Soil | ADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0182033_109058881 | 3300016319 | Soil | GTRRGVADIAGITTGGRLAHLLKDAIEWDYRQSVRHLRGWDPVAATARPSRSCQN |
| Ga0182033_116310131 | 3300016319 | Soil | GTRRGVADIAGITTGGRLAHVLKDAIEWEYRQSVKHLRGWDPVAL |
| Ga0182033_120968372 | 3300016319 | Soil | FVVSVGTRRGVADVAGITTGGRLAHLLKDAIEWEYRQSVKHMRGWDPLA |
| Ga0182032_102739102 | 3300016357 | Soil | AVADIAGVTSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG |
| Ga0182034_108017192 | 3300016371 | Soil | AGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0182040_108391753 | 3300016387 | Soil | RGVADIAGITTGGRLAHLLKDTIEWEYRQSVRHLRGWDPVAR |
| Ga0182037_107464601 | 3300016404 | Soil | KGFVVSVGTRRGVADVAGITTGGRLAHLLKDAIEWEYRQSVKHMRGWDPLA |
| Ga0182039_102433531 | 3300016422 | Soil | VGTRRGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0182038_111458722 | 3300016445 | Soil | HDKGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0182038_112727362 | 3300016445 | Soil | RDKGFVVSVGTRRAVADIAGITSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG |
| Ga0182038_116529081 | 3300016445 | Soil | HDKGFVISVGTRRGVVNIAGITTGGRLAHLLKDAIEWEYRQSVTHLRG |
| Ga0134074_13417151 | 3300017657 | Grasslands Soil | HDKGFVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPV |
| Ga0187820_11818112 | 3300017924 | Freshwater Sediment | VVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0187807_10792081 | 3300017926 | Freshwater Sediment | IPHITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVSR |
| Ga0187806_10909182 | 3300017928 | Freshwater Sediment | RRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0187809_102310921 | 3300017937 | Freshwater Sediment | VGTRRGVADIAGLTTGGRLTHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0187808_100869751 | 3300017942 | Freshwater Sediment | ADIAGVTTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0187808_103030042 | 3300017942 | Freshwater Sediment | GAHRGVADIARITIGGRMAHLLKDAIEWEYRQSVRHLRGWDPVNA |
| Ga0187808_104699621 | 3300017942 | Freshwater Sediment | KGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0187780_100057911 | 3300017973 | Tropical Peatland | GTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0187777_104147301 | 3300017974 | Tropical Peatland | GITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0187777_113477082 | 3300017974 | Tropical Peatland | AGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0184610_13140991 | 3300017997 | Groundwater Sediment | SVGARRGVADIAGITSGGQLAHLLKDAIEWEYRQSVSHLRSWDPVAR |
| Ga0184621_101048402 | 3300018054 | Groundwater Sediment | FVVSVGTRRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPIAR |
| Ga0184621_101833961 | 3300018054 | Groundwater Sediment | DKGFVVSVGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVSHLRSWDPVAR |
| Ga0187766_1000850910 | 3300018058 | Tropical Peatland | VADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0187766_114316771 | 3300018058 | Tropical Peatland | DKGFVVSVGTRRGVADIAGLTTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0187765_104474602 | 3300018060 | Tropical Peatland | GFVVSVGTRRGVADIAGITTGGRAAHLLKDAIEWEYRQSVKHLRGWDPVPG |
| Ga0184619_101480742 | 3300018061 | Groundwater Sediment | FVVSVGTRRGVADIASITSGGQLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0184609_102504622 | 3300018076 | Groundwater Sediment | VVSVGTRRGVADIASITSGGQLAHLLKDAIEWEYRQSVSHLRSWDPVAR |
| Ga0184625_104716281 | 3300018081 | Groundwater Sediment | VGTRRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPIAR |
| Ga0184625_106062971 | 3300018081 | Groundwater Sediment | IAGITTGGQLAHLLKDAIEWEYRQSVSHLRGWDPVAR |
| Ga0187774_110972532 | 3300018089 | Tropical Peatland | SVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0190272_127198811 | 3300018429 | Soil | DKGFVVSVGTRRGVADIAGITTGGRLAHLLKDTIEWEYRQSVRHLRGWDPVAR |
| Ga0190275_114588902 | 3300018432 | Soil | VSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0066667_110248812 | 3300018433 | Grasslands Soil | SVGTSRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAQ |
| Ga0190273_101351073 | 3300018920 | Soil | VADIAGITTGGRLAHLLKDTIEWEYRQSVRHLRGWDPVAR |
| Ga0173481_102542961 | 3300019356 | Soil | VADIAGITSGGQLAHLLKDAIEWEYRQSVRHLRGWDPIAG |
| Ga0193704_10084241 | 3300019867 | Soil | VVSVGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAM |
| Ga0193738_11004022 | 3300020020 | Soil | SVGARRGVAHIADITTGGRLAHVLKDAIEWEYRESVKHLRGWDPLTV |
| Ga0206356_107786001 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGVADIAGITTGGRLAHLLKDAIEWEYCQSVRHLRG |
| Ga0206356_110674601 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP |
| Ga0206354_100661151 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGVADIAGITSGGRLAHFLKDAIEWEYRQSVKHLRGWDPATL |
| Ga0206353_108790773 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPAA |
| Ga0210403_107499213 | 3300020580 | Soil | RGVADIAGITTGGRLAHRLKDAIEWEYRQSVKHLRGWDPV |
| Ga0210399_101735113 | 3300020581 | Soil | GVADIAGITTGGRLAHRLKDAIEWEYRQSVKHLRGWDPV |
| Ga0210399_111345262 | 3300020581 | Soil | GITSGGQLAHLLKDAIEWEYRQSVKHLRGWDPVPG |
| Ga0210399_113538181 | 3300020581 | Soil | GTRRGVAGIAGITTGGRLAHLLKDAIEWEYRQSVTHLRGWDPV |
| Ga0210401_104533133 | 3300020583 | Soil | DKWFVVSVGTRRGVADIADITTSGRLAHLLKDAIEWEYRQSVRHLRGWDPVAI |
| Ga0210381_100335643 | 3300021078 | Groundwater Sediment | GTRRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPIAR |
| Ga0210408_109129121 | 3300021178 | Soil | VSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVTHLRGWDPV |
| Ga0210385_108783581 | 3300021402 | Soil | GVADVAGITSGGRTAHLLKDAIEWEYRQSVRHLRGWDPTAR |
| Ga0210389_103398863 | 3300021404 | Soil | ADIASITTSGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0210383_111215181 | 3300021407 | Soil | GVADIADITTSGRLAHLLKDAIEWEYRQSVRHLRGWDPVAI |
| Ga0210398_100927193 | 3300021477 | Soil | RRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAL |
| Ga0210402_101104055 | 3300021478 | Soil | VSVGTSRGVADVAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAG |
| Ga0210402_104763033 | 3300021478 | Soil | IAGITTGGRLAHRLKDAIEWEYRQSVKHLRGWDPV |
| Ga0210409_105275982 | 3300021559 | Soil | HDKGFVVSVGTSRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIPG |
| Ga0210409_109991841 | 3300021559 | Soil | DIADITTSGRLAHLLKDAIEWEYRQSVRHLRGWDPVAI |
| Ga0224712_100524621 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLHGWDPVS |
| Ga0222622_101561293 | 3300022756 | Groundwater Sediment | ADIAGITSGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAM |
| Ga0222622_111487441 | 3300022756 | Groundwater Sediment | LGRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVSHLRSWDPVAR |
| Ga0247788_10725601 | 3300022901 | Soil | DIAGITSGGRLTHLLKDLIEWEYRQSVTHLRGWDPLAS |
| Ga0247678_10711822 | 3300024325 | Soil | IAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP |
| Ga0207684_107767121 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VGTSRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPIPG |
| Ga0207684_109286921 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGVADVAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAM |
| Ga0207684_115397911 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPAAW |
| Ga0207671_108511283 | 3300025914 | Corn Rhizosphere | IAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV |
| Ga0207693_106479972 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VGTRRGVADIVGIATGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAR |
| Ga0207663_106295841 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPG |
| Ga0207663_117381351 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VADIAGITSGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0207652_103516273 | 3300025921 | Corn Rhizosphere | ADVAGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG |
| Ga0207652_104534144 | 3300025921 | Corn Rhizosphere | GVADIAGITTGGRLAHVLKDAIEWEYRQSVRHLRGWDPVGPLSRPR |
| Ga0207652_116465381 | 3300025921 | Corn Rhizosphere | GVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV |
| Ga0207646_106526881 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RGVADIAGITTGGHLAHLLKDAIEWEYRQSVTHLRGWDPIAL |
| Ga0207646_108249631 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GVADIVGIATGGRLAHLLKDAIEWEYRQSVTHLRGWDPIAR |
| Ga0207681_110246243 | 3300025923 | Switchgrass Rhizosphere | RGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV |
| Ga0207687_101703921 | 3300025927 | Miscanthus Rhizosphere | ADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPG |
| Ga0207706_110791201 | 3300025933 | Corn Rhizosphere | FVVSVGTRRGVADIAGISSGGRLAHLLKDIIEWEYRQSVTHLRGWDPLAR |
| Ga0207665_103263993 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPVG |
| Ga0207665_109836071 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VGTRRGVAEIASITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0207711_105485803 | 3300025941 | Switchgrass Rhizosphere | DIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV |
| Ga0207689_108002661 | 3300025942 | Miscanthus Rhizosphere | SVGTRRGVADIAGISSGGRLAHLLKDIIEWEYRQSVTHLRGWDPLAR |
| Ga0207661_119016122 | 3300025944 | Corn Rhizosphere | PRRGVADFAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0207667_103942543 | 3300025949 | Corn Rhizosphere | TRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV |
| Ga0207712_111905251 | 3300025961 | Switchgrass Rhizosphere | KGFVVSVGTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV |
| Ga0207640_114671502 | 3300025981 | Corn Rhizosphere | GTRRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPV |
| Ga0207677_103960493 | 3300026023 | Miscanthus Rhizosphere | RRGVADIAGITTGGRLAHGLKDAIEWEYRQSVKHLRGWDPG |
| Ga0207678_108901673 | 3300026067 | Corn Rhizosphere | VGTRRGVADVAGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG |
| Ga0207702_118107252 | 3300026078 | Corn Rhizosphere | GVADVAGITSGGRIAHLLKDAIEWEYRQSVKHLRGWDPVG |
| Ga0207648_107972562 | 3300026089 | Miscanthus Rhizosphere | VAVSLVADIAGITTGGRLAHLLKDAIEWEYRQSVKYLRGWDPLAV |
| Ga0209648_106388832 | 3300026551 | Grasslands Soil | GVADIAGITTGGHLAHLLKDAIEWEYRQSVTHLRGWDPVAR |
| Ga0209732_10879952 | 3300027117 | Forest Soil | GTHRGVVDIAGITSGGHLAHLLKDAIEWEYRQSVKHLRGWDPVPG |
| Ga0208985_10418051 | 3300027528 | Forest Soil | VSVGTRRGVADVAGVTSGGRMAHVLKDAIEWEYRQSVKHLHGWDPAG |
| Ga0209178_12201481 | 3300027725 | Agricultural Soil | RRGVADIAGLTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0209328_101568061 | 3300027727 | Forest Soil | FHDKGFVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0209693_102163532 | 3300027855 | Soil | GVADIAGITSGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0209283_100908241 | 3300027875 | Vadose Zone Soil | IAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL |
| Ga0209590_100391546 | 3300027882 | Vadose Zone Soil | SVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGSDPVAV |
| Ga0209488_100643053 | 3300027903 | Vadose Zone Soil | GITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAM |
| Ga0209006_101054634 | 3300027908 | Forest Soil | THRGVADVAGITSGGRAAHLLKDAIEWEYRQSVKHLRGWDPVPG |
| Ga0209526_107818772 | 3300028047 | Forest Soil | VADIAGITSGGRMAHLLKDAIEWEYRQSVRHLRGWDPAGR |
| Ga0247675_10162232 | 3300028072 | Soil | GFVVSVGTRRGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVP |
| Ga0268265_120658801 | 3300028380 | Switchgrass Rhizosphere | VGTSRGVADIAGITTGGRLAHVLKDAIEWEYRQSVKHLRGWSPVTR |
| Ga0137415_101855831 | 3300028536 | Vadose Zone Soil | VVSVGTRRGVADIAGVTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0247828_108455361 | 3300028587 | Soil | VGTRRGVADIAGFTSGGKLAHLLKDAIEWEYRQSVKHLRGWDPIG |
| Ga0247821_101687003 | 3300028596 | Soil | FVVSVGTSRGVADVAGVTTGGRLAHLLKDAIEWQYRQSVKHLRGWDPMAR |
| Ga0247820_103962522 | 3300028597 | Soil | RGVADVAGVTTGGRLAHLLKDAIEWQYRQSVKHLRGWDPMAR |
| Ga0307298_100016177 | 3300028717 | Soil | GFVVSVGARRGVADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG |
| Ga0307319_102978651 | 3300028722 | Soil | VVSVGARRGVADIAGITSGGQLAHLLKDAIEWEYRQSVSHLRGWDPVAR |
| Ga0307318_102704282 | 3300028744 | Soil | RRGVADIAGITSGGQLAHLLKDAIEWEYRQSVSHLRSWDPVAR |
| Ga0307280_100552141 | 3300028768 | Soil | HDKGFVVSVGARRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLAV |
| Ga0307290_100291611 | 3300028791 | Soil | RGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV |
| Ga0307290_100323903 | 3300028791 | Soil | GIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAM |
| Ga0307504_104010962 | 3300028792 | Soil | ADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0307299_103855581 | 3300028793 | Soil | VVSVGARRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLAV |
| Ga0307503_103324441 | 3300028802 | Soil | GITTGGQLAHLLKDAIEWEYRQSVRHLRGWSPVTR |
| Ga0307305_105313942 | 3300028807 | Soil | AGITTGGQLAHLLKDAIEWEYRQSVTHLRGWDPLAS |
| Ga0307294_100930612 | 3300028810 | Soil | YKGFVVSVGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAM |
| Ga0307302_100458803 | 3300028814 | Soil | VGARRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV |
| Ga0307302_106540791 | 3300028814 | Soil | PRRGVAALAGITTGGRLAHVLKDAVEWEYRQSVQRLRGWDPLAV |
| Ga0307296_102001811 | 3300028819 | Soil | FVVSVGARRGVADIAGITTGGRLAHLLKDAIEWEYRESVKHLRGWDPLTV |
| Ga0307296_102315781 | 3300028819 | Soil | VGTRRGVADIAGITTGGRLAHRLKDAIEWEYRQSVKHLRGWDPV |
| Ga0307310_100797171 | 3300028824 | Soil | RRGVADIAGITSGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAM |
| Ga0307289_100111366 | 3300028875 | Soil | RGVADIGGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV |
| Ga0307300_102109791 | 3300028880 | Soil | DIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLAV |
| Ga0307304_100139621 | 3300028885 | Soil | DIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV |
| Ga0307304_105720652 | 3300028885 | Soil | FHDKGFVVSVGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVRYLRGWDPVAM |
| Ga0268240_101185651 | 3300030496 | Soil | FHDKGFVVSVGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVKHLRGWDPVAH |
| Ga0308190_10335652 | 3300030993 | Soil | GARRGVADIGGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV |
| Ga0170834_1061291542 | 3300031057 | Forest Soil | VSVGTRRGVADIAGITTGGRSAHLLKDAIEWEYRQSIRHLRGWDPVAR |
| Ga0308189_101332201 | 3300031058 | Soil | VVSVGTRRGAADIAGITSGGRLAHLLKDLIEWEYRQSVTHLRGWDPLAG |
| Ga0308192_10113112 | 3300031082 | Soil | SVGARRGVADIGGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV |
| Ga0308193_10040981 | 3300031096 | Soil | GFVVSVGARRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV |
| Ga0308195_10048901 | 3300031123 | Soil | DIGGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV |
| Ga0170824_1055079691 | 3300031231 | Forest Soil | DIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG |
| Ga0318534_100277891 | 3300031544 | Soil | VADIAGITTGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318534_101701871 | 3300031544 | Soil | RGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318534_102059092 | 3300031544 | Soil | ADIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG |
| Ga0318534_103994441 | 3300031544 | Soil | AGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0318573_104770581 | 3300031564 | Soil | DIAGVTSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG |
| Ga0318515_101105783 | 3300031572 | Soil | GITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318515_104950862 | 3300031572 | Soil | DKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0310915_106450882 | 3300031573 | Soil | DKGFVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPLPG |
| Ga0318555_102061571 | 3300031640 | Soil | GVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0318555_104164761 | 3300031640 | Soil | AGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWNPVAV |
| Ga0318555_104653612 | 3300031640 | Soil | VVSVGTRRGVAGIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR |
| Ga0318555_105665702 | 3300031640 | Soil | VADIAGVTTGGRLAHLLKDAIEWEYRQSVRHMRGWDPVAL |
| Ga0318542_101005681 | 3300031668 | Soil | VSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318542_101067381 | 3300031668 | Soil | VGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318542_102653342 | 3300031668 | Soil | DKGFVVSVGTRRGVADVAGITTGGRLAHLLKDAIEWEYRQSVKHMRGWDPLA |
| Ga0318542_106555431 | 3300031668 | Soil | DKGFVVSVGTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318561_104211561 | 3300031679 | Soil | TRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318572_106012961 | 3300031681 | Soil | RRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0318572_108768812 | 3300031681 | Soil | FVVSVGPRRAVADIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG |
| Ga0318572_109083911 | 3300031681 | Soil | ADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR |
| Ga0310686_1108366562 | 3300031708 | Soil | DKGFVVSVGTRHGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPIAR |
| Ga0310686_1117336481 | 3300031708 | Soil | VADIAAITTSGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0306917_115769722 | 3300031719 | Soil | DIAGITTGGRLAHVLKDAIEWEYRQSVKHLRGWDPVAL |
| Ga0307469_121386301 | 3300031720 | Hardwood Forest Soil | GFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPLAL |
| Ga0318493_101342141 | 3300031723 | Soil | GFVVSVGTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHMRGWDPVAL |
| Ga0318493_103652413 | 3300031723 | Soil | TRRGVADIAGVTTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAL |
| Ga0318501_100261001 | 3300031736 | Soil | SRGVADIAGITSGGHAAHLLKDAIEWEYRQSVRHLRGWDPVPG |
| Ga0318501_103675753 | 3300031736 | Soil | TRRGVADIAGITTGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318501_103726972 | 3300031736 | Soil | TSRGVADVAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0306918_111602971 | 3300031744 | Soil | GVADIAGVTSGGRLAHLLKDAIEWEYRQSVSHLRGWDPVAM |
| Ga0306918_114613441 | 3300031744 | Soil | VGTRRGVADIVGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0306918_115671581 | 3300031744 | Soil | RGVADIAGLTTGGHLAHLLKDAIEWEYRQTVKHLRGWDPIAL |
| Ga0318502_101869112 | 3300031747 | Soil | GITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVPG |
| Ga0318492_102020623 | 3300031748 | Soil | GFVVSVGTRRGVADIAGITTGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318492_106131371 | 3300031748 | Soil | FHDKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR |
| Ga0318494_107653841 | 3300031751 | Soil | AGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318535_101255631 | 3300031764 | Soil | VSVGTRRGVAGIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318535_102028742 | 3300031764 | Soil | KGFVVSVGTRRGVADIAGITTGGRSAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318554_101343393 | 3300031765 | Soil | GFVVSVGTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAL |
| Ga0318554_105764291 | 3300031765 | Soil | FHDKGFVVSVGTRRGVADIANITTSGRLAHLLKDSIEWEYRQSVRHLRGWDPVAV |
| Ga0318554_106175821 | 3300031765 | Soil | FHDRGFVVSVGTSRGVAEIAGLTAGGHLAHLLKDAIEWEYRQSVKHLHGWDPVAR |
| Ga0318554_108073282 | 3300031765 | Soil | KGFVVSVGTRRGVADIAGVTSGGHLAHLLKDAIEWEYRQSVRHMRGWDPVAL |
| Ga0318521_102630903 | 3300031770 | Soil | VADIAGITSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG |
| Ga0318521_104860141 | 3300031770 | Soil | GFVVSVGTRRGVADIAGITTGGRLAHLLKDSIEWEYRQSVRHLRGWDPIAR |
| Ga0318546_103198571 | 3300031771 | Soil | FHDKGFVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPIAR |
| Ga0318498_102211881 | 3300031778 | Soil | AGITSGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0318566_100290581 | 3300031779 | Soil | DKGFVVSVGTSRGVADIAGITSGGHAAHLLKDAIEWEYRQSVRHLRGWDPVPG |
| Ga0318566_101414462 | 3300031779 | Soil | KGFVVSVGTRRGVADIAGITTGGRLAHVLKDAIEWEYRQSVKHLRGWDPVAL |
| Ga0318566_103303661 | 3300031779 | Soil | TRRAVADIAGITSGGRVAHLLKDAIEWEYRQSVRHLRGWDPIPG |
| Ga0318566_103541741 | 3300031779 | Soil | FVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318547_108618641 | 3300031781 | Soil | TRRGVADIAGITTGGRLAHLLKDTIEWEYRQSVRHLRGWDPVAR |
| Ga0318552_100302641 | 3300031782 | Soil | VFEQVGRPVADIAGVTSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG |
| Ga0318503_102362811 | 3300031794 | Soil | KGFVVSVGTRRGVADVAGITTGGRVAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0318557_104080841 | 3300031795 | Soil | ADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318576_102381071 | 3300031796 | Soil | FHDKGFVVSVGTRRGVADVAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318565_101538751 | 3300031799 | Soil | VSVGTRRGVADIAGITTGGRSAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318565_103959902 | 3300031799 | Soil | GITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0318565_105082392 | 3300031799 | Soil | FSVGIRRGVADIAGVTTDGRLAHLLKDAIEWEYRQSVRHMRGWDPVAL |
| Ga0318565_105282951 | 3300031799 | Soil | GVADIAGITSGGHVAHLLKDAIEWEYRQSVRHLRGWDPVQG |
| Ga0318565_105581141 | 3300031799 | Soil | IAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR |
| Ga0318497_100278964 | 3300031805 | Soil | DKGFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318497_107792071 | 3300031805 | Soil | GFVVSVGTRRGVADIAGITTGGRLAHLLKDTIEWEYRQSVRHLRGWDPVAR |
| Ga0318497_107842301 | 3300031805 | Soil | FVVSVGTRRGVADIAGMTTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0318568_100944781 | 3300031819 | Soil | GTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0318568_102630421 | 3300031819 | Soil | DVAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0318568_105188211 | 3300031819 | Soil | ADIANITTSGRLAHLLKDSIEWEYRQSVRHLRGWDPVAV |
| Ga0318568_106519261 | 3300031819 | Soil | GCNAGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAV |
| Ga0318568_106825191 | 3300031819 | Soil | VGTRRGVADIAAITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG |
| Ga0318568_107808292 | 3300031819 | Soil | GFVVSVGTRRGVADIAGVTTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318567_100589134 | 3300031821 | Soil | VSVGTRRAVADIAGITSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG |
| Ga0307478_107419952 | 3300031823 | Hardwood Forest Soil | DKGFVVSVGTSRGVADIAGITTGGRAAHLLKDAIEWEYRQSVRHLRG |
| Ga0307413_115915202 | 3300031824 | Rhizosphere | VVSVGIRRGVADIAGITSGGQLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0307413_120462722 | 3300031824 | Rhizosphere | KGFVVSVGMRRGVADVAGVTMGGRLAHVLKDAIEWEYRQSVKYLRGWDPLAL |
| Ga0318564_101681951 | 3300031831 | Soil | HDKGFVVSVGTRRGVADIAGITTGGRLAHLLKDTIEWEYRQSVRHLRGWDPVAR |
| Ga0318564_101938301 | 3300031831 | Soil | GVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318564_105061002 | 3300031831 | Soil | VGTRRGVADVAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0310917_107273042 | 3300031833 | Soil | VADVAGITTGGRLAHLLKDAIEWEYRQSVKHMRGWDPLA |
| Ga0318517_104525332 | 3300031835 | Soil | TRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0310907_107775492 | 3300031847 | Soil | DIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVIR |
| Ga0307410_105631411 | 3300031852 | Rhizosphere | FHEKRFVVSVGASRGVADIADITTGGRLAHLLKDAIEWEYRESVKHLRGWDPLAV |
| Ga0318495_100508271 | 3300031860 | Soil | ADVAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318495_101030451 | 3300031860 | Soil | DKGFVVSVGTRRGVAGIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR |
| Ga0318544_101157301 | 3300031880 | Soil | VGTRRGVAGIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPIAR |
| Ga0318544_103783221 | 3300031880 | Soil | HDKGFVVSVGTRRGVADIAGMTTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0318551_106699391 | 3300031896 | Soil | VVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318520_104388271 | 3300031897 | Soil | RRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0306923_105429204 | 3300031910 | Soil | RGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0306923_120745822 | 3300031910 | Soil | VSVGTRRGVADIAGVTTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAH |
| Ga0306921_103540861 | 3300031912 | Soil | AGLTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0306921_111672443 | 3300031912 | Soil | FVVSVGTRRGVADIAGITTGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0306921_115134832 | 3300031912 | Soil | TRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVPG |
| Ga0306921_125006252 | 3300031912 | Soil | VGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0310912_104542773 | 3300031941 | Soil | HDKGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0310912_107781561 | 3300031941 | Soil | GVADIAGITTGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0310910_114027801 | 3300031946 | Soil | RRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAI |
| Ga0310909_101865191 | 3300031947 | Soil | FVVSVGTRRGVADIAGITAGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0310909_107429262 | 3300031947 | Soil | KGFVVSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0310909_111945562 | 3300031947 | Soil | SRGVAEIAGFTAGGHLAHLLKDAIEWEYRQSVKHLHGWDPVAR |
| Ga0306926_1000596714 | 3300031954 | Soil | GPRRAVADIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG |
| Ga0306926_121002291 | 3300031954 | Soil | FVVSVGTRRGVADIAGITTGGRLAHVLKDAIEWEYRQSVKHLRGWDPVAL |
| Ga0318530_103812791 | 3300031959 | Soil | GTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318531_102265232 | 3300031981 | Soil | VADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0306922_116039071 | 3300032001 | Soil | VADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0318562_108741722 | 3300032008 | Soil | RGVADIAGITTGGRLAHVLKDAIEWEYRQSVKHLRGWDPVAL |
| Ga0318563_107396811 | 3300032009 | Soil | ADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAR |
| Ga0318569_102123931 | 3300032010 | Soil | TRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0310906_107760421 | 3300032013 | Soil | ADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPLTV |
| Ga0318549_105049821 | 3300032041 | Soil | DIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAL |
| Ga0318549_105320082 | 3300032041 | Soil | RGVADIADITTGGLAHLLKDAIEREYRQSVRHLRGWDPVAV |
| Ga0318545_101911792 | 3300032042 | Soil | VADIAGVTSGGRAAHLLKDAIEWEYRQSVRHLRGWDPIPG |
| Ga0318558_102252491 | 3300032044 | Soil | GFVVSVGTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318506_100437051 | 3300032052 | Soil | GVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAL |
| Ga0318506_105594852 | 3300032052 | Soil | VSVGPRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVKHLRGWDPVAR |
| Ga0318575_100382395 | 3300032055 | Soil | TRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318575_104753342 | 3300032055 | Soil | VADIAGITSGGRLAHLLKDAIEWEYRQSVTHLRGWDPVAR |
| Ga0318505_104174201 | 3300032060 | Soil | VADIAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318504_101890322 | 3300032063 | Soil | KGFVVSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPIAR |
| Ga0318504_105221921 | 3300032063 | Soil | VSVGTRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAV |
| Ga0318514_102880551 | 3300032066 | Soil | GTRRGVADIAGLTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR |
| Ga0318524_101430221 | 3300032067 | Soil | GITTGGRPAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318524_101698921 | 3300032067 | Soil | VVSVGPRRAVADIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG |
| Ga0318524_103000291 | 3300032067 | Soil | SVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0318524_106106681 | 3300032067 | Soil | VSVGTRRGVADIAGITTGGHLAHLLKDAIEWEYRQSVQHLRGWDPIPG |
| Ga0306924_111696121 | 3300032076 | Soil | RGVADVAGITTGGRLAHLLKDAIEWEYRQSVKHMRGWDPLA |
| Ga0306924_116472361 | 3300032076 | Soil | AGITTGGHLAHLLKDAIEWEYRQSVQHLHGWDPIAR |
| Ga0318525_102029291 | 3300032089 | Soil | FVVSVGTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0318525_105890802 | 3300032089 | Soil | VSVGTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHMRGWDPVAL |
| Ga0318540_106418181 | 3300032094 | Soil | VADVAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0311301_120831162 | 3300032160 | Peatlands Soil | HDKGFVVSVGNRRGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPIAR |
| Ga0307471_1018879111 | 3300032180 | Hardwood Forest Soil | GVTSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0306920_1001298261 | 3300032261 | Soil | GFVVSVGTRRGVADIAGITTGGRSAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0306920_1032431051 | 3300032261 | Soil | GTRRGVADIAGITSGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0335085_102717144 | 3300032770 | Soil | RRGVADIAGITSGGRLAHVLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0335079_119479861 | 3300032783 | Soil | VSVGTRRGVAEIAGITTGGRLAHLLKDAIEWEYRESVRHLRGWDPVAV |
| Ga0335080_108884583 | 3300032828 | Soil | VSVGTRRGVADIAGITTSGRLAHLLKDAIEWEYRESVRHLRGWDPVAV |
| Ga0335081_108726882 | 3300032892 | Soil | FHDKGFVASVGTHRGVADIAGITTGGRIAHLLKDAIEWEYRQSVKHLRGWDPVNV |
| Ga0335081_115286091 | 3300032892 | Soil | FVVSVGTRRGVADVAGITTGGHLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0335074_100483509 | 3300032895 | Soil | VADIAGITTGGRLAHLLKDAIEWEYRQSVKHLRGWDPVAA |
| Ga0335074_103528481 | 3300032895 | Soil | VADIARVTIGGRLAHLLEDAIEWEYREPVKDLRGWAQ |
| Ga0335073_108179151 | 3300033134 | Soil | VGPRRGVADIAGTTIGGRVAHLLKDAIEWEYRESVKHLRGWDPVTL |
| Ga0335077_107452321 | 3300033158 | Soil | RGVADIAGITTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAV |
| Ga0310914_105025791 | 3300033289 | Soil | VVSVGTRRGVADIAGVTTGGRLAHLLKDAIEWEYRQSVRHLRGWDPVAR |
| Ga0310914_114864571 | 3300033289 | Soil | GTSRGVADIAGITSGGHAAHLLKDAIEWEYRQSVRHLRGWDPIAR |
| ⦗Top⦘ |