| Basic Information | |
|---|---|
| Family ID | F004241 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 447 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRILSAV |
| Number of Associated Samples | 306 |
| Number of Associated Scaffolds | 447 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.29 % |
| % of genes near scaffold ends (potentially truncated) | 16.11 % |
| % of genes from short scaffolds (< 2000 bps) | 73.15 % |
| Associated GOLD sequencing projects | 276 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.192 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.172 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.450 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.336 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.97% β-sheet: 0.00% Coil/Unstructured: 53.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 447 Family Scaffolds |
|---|---|---|
| PF11295 | DUF3096 | 4.03 |
| PF03401 | TctC | 3.36 |
| PF11752 | DUF3309 | 3.13 |
| PF12680 | SnoaL_2 | 1.57 |
| PF05532 | CsbD | 1.34 |
| PF13531 | SBP_bac_11 | 1.12 |
| PF07568 | HisKA_2 | 1.12 |
| PF02839 | CBM_5_12 | 1.12 |
| PF00011 | HSP20 | 0.89 |
| PF06823 | DUF1236 | 0.89 |
| PF04226 | Transgly_assoc | 0.89 |
| PF13545 | HTH_Crp_2 | 0.67 |
| PF02518 | HATPase_c | 0.67 |
| PF01844 | HNH | 0.67 |
| PF03330 | DPBB_1 | 0.67 |
| PF08972 | DUF1902 | 0.67 |
| PF04860 | Phage_portal | 0.45 |
| PF01494 | FAD_binding_3 | 0.45 |
| PF00005 | ABC_tran | 0.45 |
| PF01850 | PIN | 0.45 |
| PF01594 | AI-2E_transport | 0.45 |
| PF02617 | ClpS | 0.45 |
| PF00313 | CSD | 0.45 |
| PF04828 | GFA | 0.45 |
| PF10439 | Bacteriocin_IIc | 0.45 |
| PF02674 | Colicin_V | 0.45 |
| PF09361 | Phasin_2 | 0.45 |
| PF00753 | Lactamase_B | 0.45 |
| PF01391 | Collagen | 0.45 |
| PF04392 | ABC_sub_bind | 0.45 |
| PF01042 | Ribonuc_L-PSP | 0.45 |
| PF13581 | HATPase_c_2 | 0.45 |
| PF01695 | IstB_IS21 | 0.45 |
| PF13560 | HTH_31 | 0.45 |
| PF10387 | DUF2442 | 0.45 |
| PF07813 | LTXXQ | 0.45 |
| PF01925 | TauE | 0.22 |
| PF08708 | PriCT_1 | 0.22 |
| PF00873 | ACR_tran | 0.22 |
| PF00149 | Metallophos | 0.22 |
| PF13410 | GST_C_2 | 0.22 |
| PF01979 | Amidohydro_1 | 0.22 |
| PF04267 | SoxD | 0.22 |
| PF10646 | Germane | 0.22 |
| PF02771 | Acyl-CoA_dh_N | 0.22 |
| PF00118 | Cpn60_TCP1 | 0.22 |
| PF02705 | K_trans | 0.22 |
| PF00211 | Guanylate_cyc | 0.22 |
| PF00128 | Alpha-amylase | 0.22 |
| PF04008 | Adenosine_kin | 0.22 |
| PF04616 | Glyco_hydro_43 | 0.22 |
| PF08471 | Ribonuc_red_2_N | 0.22 |
| PF04234 | CopC | 0.22 |
| PF02911 | Formyl_trans_C | 0.22 |
| PF04909 | Amidohydro_2 | 0.22 |
| PF02321 | OEP | 0.22 |
| PF11638 | DnaA_N | 0.22 |
| PF00216 | Bac_DNA_binding | 0.22 |
| PF01370 | Epimerase | 0.22 |
| PF03450 | CO_deh_flav_C | 0.22 |
| PF11999 | Ice_binding | 0.22 |
| PF04002 | RadC | 0.22 |
| PF00343 | Phosphorylase | 0.22 |
| PF06325 | PrmA | 0.22 |
| PF01145 | Band_7 | 0.22 |
| PF12071 | DUF3551 | 0.22 |
| PF11064 | DUF2865 | 0.22 |
| PF13392 | HNH_3 | 0.22 |
| PF06245 | DUF1015 | 0.22 |
| PF05239 | PRC | 0.22 |
| PF07369 | DUF1488 | 0.22 |
| PF00400 | WD40 | 0.22 |
| PF01402 | RHH_1 | 0.22 |
| PF00027 | cNMP_binding | 0.22 |
| PF00535 | Glycos_transf_2 | 0.22 |
| PF02586 | SRAP | 0.22 |
| PF08388 | GIIM | 0.22 |
| PF00185 | OTCace | 0.22 |
| PF03814 | KdpA | 0.22 |
| PF01048 | PNP_UDP_1 | 0.22 |
| PF04964 | Flp_Fap | 0.22 |
| PF12704 | MacB_PCD | 0.22 |
| PF00487 | FA_desaturase | 0.22 |
| PF13505 | OMP_b-brl | 0.22 |
| PF02353 | CMAS | 0.22 |
| PF08734 | GYD | 0.22 |
| PF13827 | DUF4189 | 0.22 |
| PF12778 | PXPV | 0.22 |
| PF01841 | Transglut_core | 0.22 |
| PF00459 | Inositol_P | 0.22 |
| PF12200 | DUF3597 | 0.22 |
| PF04365 | BrnT_toxin | 0.22 |
| PF13458 | Peripla_BP_6 | 0.22 |
| PF13432 | TPR_16 | 0.22 |
| PF08239 | SH3_3 | 0.22 |
| PF14403 | CP_ATPgrasp_2 | 0.22 |
| PF06277 | EutA | 0.22 |
| PF00365 | PFK | 0.22 |
| PF01546 | Peptidase_M20 | 0.22 |
| PF13646 | HEAT_2 | 0.22 |
| PF13712 | Glyco_tranf_2_5 | 0.22 |
| PF01193 | RNA_pol_L | 0.22 |
| PF08837 | DUF1810 | 0.22 |
| PF00486 | Trans_reg_C | 0.22 |
| PF00982 | Glyco_transf_20 | 0.22 |
| PF00230 | MIP | 0.22 |
| PF01842 | ACT | 0.22 |
| PF02954 | HTH_8 | 0.22 |
| PF00872 | Transposase_mut | 0.22 |
| PF00355 | Rieske | 0.22 |
| PF00180 | Iso_dh | 0.22 |
| PF13400 | Tad | 0.22 |
| PF11003 | DUF2842 | 0.22 |
| PF11604 | CusF_Ec | 0.22 |
| PF08240 | ADH_N | 0.22 |
| PF01988 | VIT1 | 0.22 |
| PF13340 | DUF4096 | 0.22 |
| PF14525 | AraC_binding_2 | 0.22 |
| PF01464 | SLT | 0.22 |
| PF07732 | Cu-oxidase_3 | 0.22 |
| PF13185 | GAF_2 | 0.22 |
| PF03641 | Lysine_decarbox | 0.22 |
| PF00106 | adh_short | 0.22 |
| PF00795 | CN_hydrolase | 0.22 |
| PF00534 | Glycos_transf_1 | 0.22 |
| PF00034 | Cytochrom_C | 0.22 |
| PF10722 | YbjN | 0.22 |
| PF05598 | DUF772 | 0.22 |
| PF07836 | DmpG_comm | 0.22 |
| PF14237 | GYF_2 | 0.22 |
| PF15919 | HicB_lk_antitox | 0.22 |
| PF08379 | Bact_transglu_N | 0.22 |
| PF00665 | rve | 0.22 |
| PF04191 | PEMT | 0.22 |
| PF14384 | BrnA_antitoxin | 0.22 |
| PF07908 | Obsolete Pfam Family | 0.22 |
| PF00589 | Phage_integrase | 0.22 |
| PF03354 | TerL_ATPase | 0.22 |
| PF00248 | Aldo_ket_red | 0.22 |
| PF03328 | HpcH_HpaI | 0.22 |
| PF08448 | PAS_4 | 0.22 |
| PF02656 | DUF202 | 0.22 |
| PF13463 | HTH_27 | 0.22 |
| PF06233 | Usg | 0.22 |
| PF13229 | Beta_helix | 0.22 |
| PF13751 | DDE_Tnp_1_6 | 0.22 |
| PF10282 | Lactonase | 0.22 |
| PF05957 | DUF883 | 0.22 |
| PF00512 | HisKA | 0.22 |
| PF00069 | Pkinase | 0.22 |
| PF02738 | MoCoBD_1 | 0.22 |
| PF04613 | LpxD | 0.22 |
| PF13817 | DDE_Tnp_IS66_C | 0.22 |
| PF00702 | Hydrolase | 0.22 |
| COG ID | Name | Functional Category | % Frequency in 447 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.36 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 1.79 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 1.34 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 1.12 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.89 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.89 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 0.89 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.45 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.45 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.45 |
| COG1286 | Colicin V production accessory protein CvpA, regulator of purF expression and biofilm formation | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.45 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.45 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.45 |
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 0.45 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.45 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.45 |
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 0.22 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.22 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.22 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.22 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.22 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.22 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.22 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.22 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.22 |
| COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 0.22 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.22 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.22 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.22 |
| COG4819 | Ethanolamine utilization protein EutA, possible chaperonin | Amino acid transport and metabolism [E] | 0.22 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.22 |
| COG4311 | Sarcosine oxidase delta subunit | Amino acid transport and metabolism [E] | 0.22 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.22 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.22 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.22 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.22 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.22 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.22 |
| COG4575 | Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family | Translation, ribosomal structure and biogenesis [J] | 0.22 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.22 |
| COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 0.22 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.22 |
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.22 |
| COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.22 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.22 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.22 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.22 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.22 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.22 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.22 |
| COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 0.22 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.22 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.22 |
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.22 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.22 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.22 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.22 |
| COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 0.22 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.22 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.22 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.22 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.22 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.22 |
| COG1761 | DNA-directed RNA polymerase, subunit L/RPAC2 | Transcription [K] | 0.22 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.22 |
| COG1839 | Adenosine/AMP kinase | Nucleotide transport and metabolism [F] | 0.22 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.22 |
| COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 0.22 |
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 0.22 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.22 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.22 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.22 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.22 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.22 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.86 % |
| Unclassified | root | N/A | 37.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02GYVQI | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 2088090004|P1_DRAFT_NODE_47904_len_1184_cov_10_514359 | Not Available | 1234 | Open in IMG/M |
| 2088090004|P1_DRAFT_NODE_58329_len_775_cov_11_389677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 825 | Open in IMG/M |
| 2088090008|P3_DRAFT_NODE_507581_len_2335_cov_21_915632 | Not Available | 2385 | Open in IMG/M |
| 2088090015|GPICI_8998385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1650 | Open in IMG/M |
| 2124908028|beta3_all_NODE_9535_len_1163_cov_11_779019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1213 | Open in IMG/M |
| 2124908043|A2_c1_ConsensusfromContig59579 | Not Available | 829 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig1203353 | Not Available | 804 | Open in IMG/M |
| 2140918006|ConsensusfromContig26549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 706 | Open in IMG/M |
| 2140918024|NODE_209741_length_1180_cov_11.294915 | Not Available | 1230 | Open in IMG/M |
| 2140918024|NODE_347176_length_709_cov_8.351199 | Not Available | 759 | Open in IMG/M |
| 2170459002|FZY7DQ102GWQ8D | Not Available | 518 | Open in IMG/M |
| 2170459003|FZN2CUW02F4SAM | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 2170459009|GA8DASG02I69CA | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 2189573002|GZIGXIF02INZZG | Not Available | 500 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0671029 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300000567|JGI12270J11330_10022769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3829 | Open in IMG/M |
| 3300000567|JGI12270J11330_10170275 | Not Available | 785 | Open in IMG/M |
| 3300000567|JGI12270J11330_10192222 | Not Available | 707 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100815239 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1677 | Open in IMG/M |
| 3300001385|JGI20193J14888_1024534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300001471|JGI12712J15308_10021293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1700 | Open in IMG/M |
| 3300001593|JGI12635J15846_10405886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300001593|JGI12635J15846_10670168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 599 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100073850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3151 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100229278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411 | 1748 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100466198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1140 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101156113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 662 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101325114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium | 611 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101695435 | Not Available | 531 | Open in IMG/M |
| 3300003861|Ga0031654_10000071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 20128 | Open in IMG/M |
| 3300004104|Ga0058891_1464748 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 706 | Open in IMG/M |
| 3300004635|Ga0062388_100508577 | Not Available | 1080 | Open in IMG/M |
| 3300005093|Ga0062594_100541928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 999 | Open in IMG/M |
| 3300005093|Ga0062594_101171080 | Not Available | 759 | Open in IMG/M |
| 3300005332|Ga0066388_100844883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1502 | Open in IMG/M |
| 3300005332|Ga0066388_101815517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1085 | Open in IMG/M |
| 3300005332|Ga0066388_102972075 | Not Available | 866 | Open in IMG/M |
| 3300005439|Ga0070711_101668355 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005529|Ga0070741_10001401 | All Organisms → cellular organisms → Bacteria | 74093 | Open in IMG/M |
| 3300005530|Ga0070679_102147656 | Not Available | 508 | Open in IMG/M |
| 3300005533|Ga0070734_10000962 | All Organisms → cellular organisms → Bacteria | 47988 | Open in IMG/M |
| 3300005537|Ga0070730_10430276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 852 | Open in IMG/M |
| 3300005541|Ga0070733_10000355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 38415 | Open in IMG/M |
| 3300005541|Ga0070733_10002334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 13625 | Open in IMG/M |
| 3300005542|Ga0070732_10089050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1810 | Open in IMG/M |
| 3300005542|Ga0070732_10215380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1149 | Open in IMG/M |
| 3300005543|Ga0070672_101843195 | Not Available | 544 | Open in IMG/M |
| 3300005554|Ga0066661_10053433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2318 | Open in IMG/M |
| 3300005559|Ga0066700_10840714 | Not Available | 615 | Open in IMG/M |
| 3300005574|Ga0066694_10149821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1106 | Open in IMG/M |
| 3300005591|Ga0070761_10070409 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300005591|Ga0070761_10161841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1314 | Open in IMG/M |
| 3300005602|Ga0070762_10421272 | Not Available | 864 | Open in IMG/M |
| 3300005602|Ga0070762_10760380 | Not Available | 653 | Open in IMG/M |
| 3300005617|Ga0068859_100004440 | All Organisms → cellular organisms → Bacteria | 14315 | Open in IMG/M |
| 3300005718|Ga0068866_10120194 | Not Available | 1479 | Open in IMG/M |
| 3300005764|Ga0066903_100112695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3739 | Open in IMG/M |
| 3300005764|Ga0066903_102106899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1086 | Open in IMG/M |
| 3300005764|Ga0066903_106470078 | Not Available | 611 | Open in IMG/M |
| 3300005764|Ga0066903_108802436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 512 | Open in IMG/M |
| 3300005833|Ga0074472_10124646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1935 | Open in IMG/M |
| 3300005921|Ga0070766_10833219 | Not Available | 629 | Open in IMG/M |
| 3300005921|Ga0070766_11285935 | Not Available | 507 | Open in IMG/M |
| 3300005938|Ga0066795_10014269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2197 | Open in IMG/M |
| 3300005938|Ga0066795_10089625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
| 3300005938|Ga0066795_10170000 | Not Available | 649 | Open in IMG/M |
| 3300005938|Ga0066795_10241854 | Not Available | 535 | Open in IMG/M |
| 3300005947|Ga0066794_10223360 | Not Available | 566 | Open in IMG/M |
| 3300005983|Ga0081540_1000065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 116905 | Open in IMG/M |
| 3300005994|Ga0066789_10204227 | Not Available | 833 | Open in IMG/M |
| 3300006028|Ga0070717_10349943 | Not Available | 1321 | Open in IMG/M |
| 3300006038|Ga0075365_10325812 | Not Available | 1082 | Open in IMG/M |
| 3300006038|Ga0075365_10468635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300006041|Ga0075023_100169344 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300006046|Ga0066652_100455657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1178 | Open in IMG/M |
| 3300006047|Ga0075024_100826000 | Not Available | 521 | Open in IMG/M |
| 3300006050|Ga0075028_100036071 | Not Available | 2301 | Open in IMG/M |
| 3300006050|Ga0075028_100797373 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006052|Ga0075029_100457089 | Not Available | 837 | Open in IMG/M |
| 3300006055|Ga0097691_1008266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5417 | Open in IMG/M |
| 3300006055|Ga0097691_1016009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3430 | Open in IMG/M |
| 3300006055|Ga0097691_1017273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3250 | Open in IMG/M |
| 3300006055|Ga0097691_1086052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 957 | Open in IMG/M |
| 3300006058|Ga0075432_10354315 | Not Available | 623 | Open in IMG/M |
| 3300006086|Ga0075019_10154150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1345 | Open in IMG/M |
| 3300006086|Ga0075019_10866761 | Not Available | 578 | Open in IMG/M |
| 3300006162|Ga0075030_100225391 | Not Available | 1506 | Open in IMG/M |
| 3300006172|Ga0075018_10230650 | Not Available | 889 | Open in IMG/M |
| 3300006172|Ga0075018_10371985 | Not Available | 721 | Open in IMG/M |
| 3300006174|Ga0075014_100028002 | Not Available | 2245 | Open in IMG/M |
| 3300006174|Ga0075014_100898014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300006176|Ga0070765_100326932 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300006176|Ga0070765_100631300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1011 | Open in IMG/M |
| 3300006176|Ga0070765_100669802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 980 | Open in IMG/M |
| 3300006176|Ga0070765_101370820 | Not Available | 666 | Open in IMG/M |
| 3300006354|Ga0075021_10012710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 4608 | Open in IMG/M |
| 3300006638|Ga0075522_10008093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7182 | Open in IMG/M |
| 3300006795|Ga0075520_1037362 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
| 3300006800|Ga0066660_10372543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1168 | Open in IMG/M |
| 3300006805|Ga0075464_10046358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2385 | Open in IMG/M |
| 3300006805|Ga0075464_10095897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1699 | Open in IMG/M |
| 3300006805|Ga0075464_10714730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus | 620 | Open in IMG/M |
| 3300006805|Ga0075464_10990712 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006805|Ga0075464_11050092 | Not Available | 512 | Open in IMG/M |
| 3300006844|Ga0075428_101183606 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 806 | Open in IMG/M |
| 3300006854|Ga0075425_100033826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5686 | Open in IMG/M |
| 3300006854|Ga0075425_100356417 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300006854|Ga0075425_102491594 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica | 573 | Open in IMG/M |
| 3300006864|Ga0066797_1110721 | Not Available | 961 | Open in IMG/M |
| 3300006871|Ga0075434_101375364 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300006871|Ga0075434_101751275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 629 | Open in IMG/M |
| 3300006871|Ga0075434_102537974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300006893|Ga0073928_10192510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1604 | Open in IMG/M |
| 3300006893|Ga0073928_10730191 | Not Available | 689 | Open in IMG/M |
| 3300006893|Ga0073928_10986648 | Not Available | 574 | Open in IMG/M |
| 3300006904|Ga0075424_102053822 | Not Available | 603 | Open in IMG/M |
| 3300006930|Ga0079303_10054701 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300006950|Ga0075524_10540172 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 520 | Open in IMG/M |
| 3300007258|Ga0099793_10350203 | Not Available | 722 | Open in IMG/M |
| 3300007258|Ga0099793_10718238 | Not Available | 504 | Open in IMG/M |
| 3300007265|Ga0099794_10490245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 646 | Open in IMG/M |
| 3300007788|Ga0099795_10014538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2443 | Open in IMG/M |
| 3300007982|Ga0102924_1000342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 58256 | Open in IMG/M |
| 3300009029|Ga0066793_10075253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1937 | Open in IMG/M |
| 3300009038|Ga0099829_10141186 | Not Available | 1915 | Open in IMG/M |
| 3300009038|Ga0099829_10239339 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300009053|Ga0105095_10504241 | Not Available | 671 | Open in IMG/M |
| 3300009088|Ga0099830_10054776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2827 | Open in IMG/M |
| 3300009089|Ga0099828_10013089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6258 | Open in IMG/M |
| 3300009090|Ga0099827_10000220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 23193 | Open in IMG/M |
| 3300009090|Ga0099827_10453216 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300009098|Ga0105245_10000531 | All Organisms → cellular organisms → Bacteria | 34976 | Open in IMG/M |
| 3300009137|Ga0066709_101136819 | Not Available | 1149 | Open in IMG/M |
| 3300009148|Ga0105243_10000430 | Not Available | 43898 | Open in IMG/M |
| 3300009156|Ga0111538_10050715 | All Organisms → cellular organisms → Bacteria | 5319 | Open in IMG/M |
| 3300009156|Ga0111538_10259761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 2198 | Open in IMG/M |
| 3300009162|Ga0075423_11867876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300009162|Ga0075423_12366633 | Not Available | 578 | Open in IMG/M |
| 3300009174|Ga0105241_10000272 | All Organisms → cellular organisms → Bacteria | 38465 | Open in IMG/M |
| 3300009176|Ga0105242_10120447 | Not Available | 2251 | Open in IMG/M |
| 3300009176|Ga0105242_10121522 | Not Available | 2242 | Open in IMG/M |
| 3300009176|Ga0105242_10901680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300009520|Ga0116214_1365188 | Not Available | 560 | Open in IMG/M |
| 3300009522|Ga0116218_1538578 | Not Available | 520 | Open in IMG/M |
| 3300009523|Ga0116221_1067351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1625 | Open in IMG/M |
| 3300009525|Ga0116220_10025670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2394 | Open in IMG/M |
| 3300009553|Ga0105249_11964686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300009643|Ga0116110_1171690 | Not Available | 711 | Open in IMG/M |
| 3300009650|Ga0105857_1023972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1620 | Open in IMG/M |
| 3300009650|Ga0105857_1082921 | Not Available | 854 | Open in IMG/M |
| 3300009662|Ga0105856_1104816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 828 | Open in IMG/M |
| 3300009698|Ga0116216_10955223 | Not Available | 512 | Open in IMG/M |
| 3300009700|Ga0116217_10042054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3383 | Open in IMG/M |
| 3300009764|Ga0116134_1075288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1248 | Open in IMG/M |
| 3300009812|Ga0105067_1071435 | Not Available | 586 | Open in IMG/M |
| 3300009819|Ga0105087_1014332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1089 | Open in IMG/M |
| 3300009839|Ga0116223_10545729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 672 | Open in IMG/M |
| 3300009839|Ga0116223_10753174 | Not Available | 558 | Open in IMG/M |
| 3300010046|Ga0126384_12338717 | Not Available | 516 | Open in IMG/M |
| 3300010343|Ga0074044_10748387 | Not Available | 638 | Open in IMG/M |
| 3300010360|Ga0126372_11606853 | Not Available | 689 | Open in IMG/M |
| 3300010376|Ga0126381_100542007 | Not Available | 1647 | Open in IMG/M |
| 3300010376|Ga0126381_101371437 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300010379|Ga0136449_100043750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10298 | Open in IMG/M |
| 3300010379|Ga0136449_100335595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2728 | Open in IMG/M |
| 3300010379|Ga0136449_100410208 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
| 3300010379|Ga0136449_100682824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1727 | Open in IMG/M |
| 3300010379|Ga0136449_100703127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1694 | Open in IMG/M |
| 3300010379|Ga0136449_100879828 | Not Available | 1464 | Open in IMG/M |
| 3300010379|Ga0136449_101692970 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300010379|Ga0136449_101983496 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 860 | Open in IMG/M |
| 3300010379|Ga0136449_103266641 | Not Available | 625 | Open in IMG/M |
| 3300010379|Ga0136449_104366250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300010400|Ga0134122_11997464 | Not Available | 618 | Open in IMG/M |
| 3300010401|Ga0134121_11344742 | Not Available | 722 | Open in IMG/M |
| 3300010403|Ga0134123_10001120 | All Organisms → cellular organisms → Bacteria | 17587 | Open in IMG/M |
| 3300010403|Ga0134123_12389903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300010880|Ga0126350_10027581 | Not Available | 831 | Open in IMG/M |
| 3300011120|Ga0150983_12948007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2 | 1874 | Open in IMG/M |
| 3300011120|Ga0150983_13270530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2 | 654 | Open in IMG/M |
| 3300011120|Ga0150983_13558260 | Not Available | 3038 | Open in IMG/M |
| 3300011120|Ga0150983_15444480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 585 | Open in IMG/M |
| 3300011269|Ga0137392_11413626 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300011271|Ga0137393_10734045 | Not Available | 845 | Open in IMG/M |
| 3300011410|Ga0137440_1137188 | Not Available | 504 | Open in IMG/M |
| 3300011421|Ga0137462_1006686 | Not Available | 2035 | Open in IMG/M |
| 3300011433|Ga0137443_1010005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2262 | Open in IMG/M |
| 3300011444|Ga0137463_1082312 | Not Available | 1208 | Open in IMG/M |
| 3300012077|Ga0153929_1051737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 715 | Open in IMG/M |
| 3300012150|Ga0153945_1061573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 657 | Open in IMG/M |
| 3300012189|Ga0137388_10073788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2852 | Open in IMG/M |
| 3300012189|Ga0137388_10669434 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300012202|Ga0137363_11388984 | Not Available | 592 | Open in IMG/M |
| 3300012205|Ga0137362_10873179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 769 | Open in IMG/M |
| 3300012209|Ga0137379_10039197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4571 | Open in IMG/M |
| 3300012211|Ga0137377_10171049 | Not Available | 2085 | Open in IMG/M |
| 3300012227|Ga0137449_1154351 | Not Available | 504 | Open in IMG/M |
| 3300012232|Ga0137435_1103325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
| 3300012355|Ga0137369_10287126 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300012357|Ga0137384_11359897 | Not Available | 558 | Open in IMG/M |
| 3300012361|Ga0137360_11224427 | Not Available | 649 | Open in IMG/M |
| 3300012363|Ga0137390_10543146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
| 3300012363|Ga0137390_10548962 | Not Available | 1126 | Open in IMG/M |
| 3300012683|Ga0137398_10404782 | Not Available | 929 | Open in IMG/M |
| 3300012685|Ga0137397_10070775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2524 | Open in IMG/M |
| 3300012685|Ga0137397_11096640 | Not Available | 580 | Open in IMG/M |
| 3300012917|Ga0137395_10466614 | Not Available | 908 | Open in IMG/M |
| 3300012923|Ga0137359_11300592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 615 | Open in IMG/M |
| 3300012923|Ga0137359_11759990 | Not Available | 507 | Open in IMG/M |
| 3300012930|Ga0137407_11417891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300012931|Ga0153915_11903647 | Not Available | 696 | Open in IMG/M |
| 3300012944|Ga0137410_11765800 | Not Available | 545 | Open in IMG/M |
| 3300012944|Ga0137410_11907728 | Not Available | 526 | Open in IMG/M |
| 3300012948|Ga0126375_10555581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 867 | Open in IMG/M |
| 3300012971|Ga0126369_12708692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 580 | Open in IMG/M |
| 3300013503|Ga0120127_10003468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2493 | Open in IMG/M |
| 3300014058|Ga0120149_1160173 | Not Available | 622 | Open in IMG/M |
| 3300014158|Ga0181521_10410449 | Not Available | 665 | Open in IMG/M |
| 3300014159|Ga0181530_10018761 | All Organisms → cellular organisms → Bacteria | 5398 | Open in IMG/M |
| 3300014164|Ga0181532_10063517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2393 | Open in IMG/M |
| 3300014164|Ga0181532_10250368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1018 | Open in IMG/M |
| 3300014165|Ga0181523_10479049 | Not Available | 688 | Open in IMG/M |
| 3300014200|Ga0181526_10220244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1212 | Open in IMG/M |
| 3300014200|Ga0181526_10542837 | Not Available | 735 | Open in IMG/M |
| 3300014489|Ga0182018_10023306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4045 | Open in IMG/M |
| 3300014489|Ga0182018_10249204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 978 | Open in IMG/M |
| 3300014489|Ga0182018_10299457 | Not Available | 875 | Open in IMG/M |
| 3300014492|Ga0182013_10065456 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2640 | Open in IMG/M |
| 3300014495|Ga0182015_10210605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1296 | Open in IMG/M |
| 3300014501|Ga0182024_10002981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 41063 | Open in IMG/M |
| 3300014501|Ga0182024_10040272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7708 | Open in IMG/M |
| 3300014501|Ga0182024_10174967 | All Organisms → cellular organisms → Bacteria | 2973 | Open in IMG/M |
| 3300014501|Ga0182024_10258426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2330 | Open in IMG/M |
| 3300014501|Ga0182024_11627057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
| 3300014657|Ga0181522_10669984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 632 | Open in IMG/M |
| 3300014838|Ga0182030_10996773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300014879|Ga0180062_1005730 | All Organisms → Viruses → Predicted Viral | 2447 | Open in IMG/M |
| 3300015080|Ga0167639_1000134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10580 | Open in IMG/M |
| 3300015160|Ga0167642_1006651 | Not Available | 2097 | Open in IMG/M |
| 3300015371|Ga0132258_10467378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3148 | Open in IMG/M |
| 3300016371|Ga0182034_11317711 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300016371|Ga0182034_11917008 | Not Available | 523 | Open in IMG/M |
| 3300016730|Ga0181515_1054760 | Not Available | 846 | Open in IMG/M |
| 3300017822|Ga0187802_10001458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6387 | Open in IMG/M |
| 3300017823|Ga0187818_10383203 | Not Available | 623 | Open in IMG/M |
| 3300017925|Ga0187856_1016445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3946 | Open in IMG/M |
| 3300017925|Ga0187856_1078320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1360 | Open in IMG/M |
| 3300017927|Ga0187824_10103036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300017940|Ga0187853_10064875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1847 | Open in IMG/M |
| 3300017946|Ga0187879_10501737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300017955|Ga0187817_10067904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2215 | Open in IMG/M |
| 3300017972|Ga0187781_10137608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1709 | Open in IMG/M |
| 3300017996|Ga0187891_1037468 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300018017|Ga0187872_10036899 | All Organisms → cellular organisms → Bacteria | 2692 | Open in IMG/M |
| 3300018019|Ga0187874_10365196 | Not Available | 583 | Open in IMG/M |
| 3300018026|Ga0187857_10306694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 724 | Open in IMG/M |
| 3300018027|Ga0184605_10027529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2326 | Open in IMG/M |
| 3300018030|Ga0187869_10513711 | Not Available | 569 | Open in IMG/M |
| 3300018056|Ga0184623_10104780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1307 | Open in IMG/M |
| 3300018057|Ga0187858_10489864 | Not Available | 753 | Open in IMG/M |
| 3300018429|Ga0190272_11685013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300018468|Ga0066662_10113896 | Not Available | 1954 | Open in IMG/M |
| 3300018469|Ga0190270_10091949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22 | 2292 | Open in IMG/M |
| 3300018469|Ga0190270_10678565 | Not Available | 1018 | Open in IMG/M |
| 3300018469|Ga0190270_11261929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300018476|Ga0190274_10653710 | Not Available | 1088 | Open in IMG/M |
| 3300018476|Ga0190274_12412499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300019888|Ga0193751_1000092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 79217 | Open in IMG/M |
| 3300019888|Ga0193751_1000233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 49184 | Open in IMG/M |
| 3300019888|Ga0193751_1045657 | Not Available | 1922 | Open in IMG/M |
| 3300020059|Ga0193745_1024597 | Not Available | 1320 | Open in IMG/M |
| 3300020140|Ga0179590_1004336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2682 | Open in IMG/M |
| 3300020199|Ga0179592_10003257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6845 | Open in IMG/M |
| 3300020579|Ga0210407_10604156 | Not Available | 855 | Open in IMG/M |
| 3300020579|Ga0210407_10646422 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300020581|Ga0210399_10001349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 19131 | Open in IMG/M |
| 3300020581|Ga0210399_10300527 | Not Available | 1340 | Open in IMG/M |
| 3300020581|Ga0210399_10817976 | Not Available | 760 | Open in IMG/M |
| 3300020582|Ga0210395_10006810 | All Organisms → cellular organisms → Bacteria | 8665 | Open in IMG/M |
| 3300020582|Ga0210395_10417776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1009 | Open in IMG/M |
| 3300021073|Ga0210378_10255552 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 663 | Open in IMG/M |
| 3300021086|Ga0179596_10248968 | Not Available | 877 | Open in IMG/M |
| 3300021088|Ga0210404_10208505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1050 | Open in IMG/M |
| 3300021090|Ga0210377_10021824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4676 | Open in IMG/M |
| 3300021168|Ga0210406_10624399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
| 3300021170|Ga0210400_11579795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300021171|Ga0210405_10644065 | Not Available | 823 | Open in IMG/M |
| 3300021171|Ga0210405_10747857 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300021178|Ga0210408_10000115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 127037 | Open in IMG/M |
| 3300021178|Ga0210408_10285239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1316 | Open in IMG/M |
| 3300021180|Ga0210396_11058881 | Not Available | 685 | Open in IMG/M |
| 3300021180|Ga0210396_11240025 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300021344|Ga0193719_10024136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2602 | Open in IMG/M |
| 3300021401|Ga0210393_10437778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1067 | Open in IMG/M |
| 3300021401|Ga0210393_11048946 | Not Available | 659 | Open in IMG/M |
| 3300021402|Ga0210385_11164202 | Not Available | 592 | Open in IMG/M |
| 3300021404|Ga0210389_10124385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1993 | Open in IMG/M |
| 3300021405|Ga0210387_11713410 | Not Available | 532 | Open in IMG/M |
| 3300021406|Ga0210386_10233824 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300021406|Ga0210386_10458261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1101 | Open in IMG/M |
| 3300021407|Ga0210383_10876704 | Not Available | 766 | Open in IMG/M |
| 3300021407|Ga0210383_11176674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300021420|Ga0210394_10289131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense | 1437 | Open in IMG/M |
| 3300021474|Ga0210390_11179036 | Not Available | 619 | Open in IMG/M |
| 3300021474|Ga0210390_11617968 | Not Available | 509 | Open in IMG/M |
| 3300021477|Ga0210398_11295511 | Not Available | 573 | Open in IMG/M |
| 3300021478|Ga0210402_12025465 | Not Available | 502 | Open in IMG/M |
| 3300021479|Ga0210410_10093145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2656 | Open in IMG/M |
| 3300021479|Ga0210410_10700138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 895 | Open in IMG/M |
| 3300021559|Ga0210409_11445552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 563 | Open in IMG/M |
| 3300022553|Ga0212124_10747575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300022557|Ga0212123_10177415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1608 | Open in IMG/M |
| 3300022557|Ga0212123_10389907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 937 | Open in IMG/M |
| 3300022726|Ga0242654_10410051 | Not Available | 522 | Open in IMG/M |
| 3300022889|Ga0247785_1035632 | Not Available | 596 | Open in IMG/M |
| 3300024347|Ga0179591_1028396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4080 | Open in IMG/M |
| 3300025457|Ga0208850_1003017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3892 | Open in IMG/M |
| 3300025457|Ga0208850_1006299 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
| 3300025457|Ga0208850_1008379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2032 | Open in IMG/M |
| 3300025457|Ga0208850_1021855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1136 | Open in IMG/M |
| 3300025457|Ga0208850_1026239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1018 | Open in IMG/M |
| 3300025464|Ga0208076_1014300 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300025481|Ga0208079_1059374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 831 | Open in IMG/M |
| 3300025505|Ga0207929_1000552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 10213 | Open in IMG/M |
| 3300025527|Ga0208714_1024848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1430 | Open in IMG/M |
| 3300025544|Ga0208078_1033651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1121 | Open in IMG/M |
| 3300025553|Ga0208080_1045846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1163 | Open in IMG/M |
| 3300025581|Ga0208355_1079658 | Not Available | 727 | Open in IMG/M |
| 3300025625|Ga0208219_1014243 | Not Available | 2474 | Open in IMG/M |
| 3300025854|Ga0209176_10003539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2820 | Open in IMG/M |
| 3300025891|Ga0209585_10171288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 844 | Open in IMG/M |
| 3300025891|Ga0209585_10339603 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 606 | Open in IMG/M |
| 3300025896|Ga0208916_10382527 | Not Available | 614 | Open in IMG/M |
| 3300025896|Ga0208916_10440153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300025910|Ga0207684_11357650 | Not Available | 583 | Open in IMG/M |
| 3300025911|Ga0207654_10000186 | All Organisms → cellular organisms → Bacteria | 38488 | Open in IMG/M |
| 3300025915|Ga0207693_10853674 | Not Available | 700 | Open in IMG/M |
| 3300025925|Ga0207650_10837864 | Not Available | 780 | Open in IMG/M |
| 3300025927|Ga0207687_10000906 | All Organisms → cellular organisms → Bacteria | 20175 | Open in IMG/M |
| 3300025934|Ga0207686_10000306 | All Organisms → cellular organisms → Bacteria | 35551 | Open in IMG/M |
| 3300025934|Ga0207686_10002479 | Not Available | 10021 | Open in IMG/M |
| 3300025934|Ga0207686_10903621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300025935|Ga0207709_10000387 | Not Available | 43799 | Open in IMG/M |
| 3300025961|Ga0207712_10032887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3502 | Open in IMG/M |
| 3300025961|Ga0207712_12047940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300026078|Ga0207702_10971474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense | 842 | Open in IMG/M |
| 3300026220|Ga0209855_1039754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300026300|Ga0209027_1072238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1279 | Open in IMG/M |
| 3300027537|Ga0209419_1025671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300027587|Ga0209220_1190017 | Not Available | 523 | Open in IMG/M |
| 3300027603|Ga0209331_1068824 | Not Available | 884 | Open in IMG/M |
| 3300027629|Ga0209422_1084118 | Not Available | 743 | Open in IMG/M |
| 3300027648|Ga0209420_1000759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16152 | Open in IMG/M |
| 3300027678|Ga0209011_1044044 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300027684|Ga0209626_1069366 | Not Available | 894 | Open in IMG/M |
| 3300027715|Ga0208665_10038676 | Not Available | 1357 | Open in IMG/M |
| 3300027735|Ga0209261_10013103 | Not Available | 2078 | Open in IMG/M |
| 3300027783|Ga0209448_10127575 | Not Available | 851 | Open in IMG/M |
| 3300027819|Ga0209514_10236333 | Not Available | 883 | Open in IMG/M |
| 3300027819|Ga0209514_10238893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 876 | Open in IMG/M |
| 3300027819|Ga0209514_10272825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 791 | Open in IMG/M |
| 3300027826|Ga0209060_10000760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 46875 | Open in IMG/M |
| 3300027835|Ga0209515_10504196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 625 | Open in IMG/M |
| 3300027835|Ga0209515_10598764 | Not Available | 553 | Open in IMG/M |
| 3300027846|Ga0209180_10226046 | Not Available | 1078 | Open in IMG/M |
| 3300027854|Ga0209517_10065906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2604 | Open in IMG/M |
| 3300027862|Ga0209701_10419484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300027866|Ga0209813_10168578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 794 | Open in IMG/M |
| 3300027867|Ga0209167_10000126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 74805 | Open in IMG/M |
| 3300027867|Ga0209167_10000142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 69929 | Open in IMG/M |
| 3300027882|Ga0209590_10019248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3412 | Open in IMG/M |
| 3300027882|Ga0209590_10058581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2176 | Open in IMG/M |
| 3300027889|Ga0209380_10534360 | Not Available | 682 | Open in IMG/M |
| 3300027894|Ga0209068_10001226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12932 | Open in IMG/M |
| 3300027895|Ga0209624_10019101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4349 | Open in IMG/M |
| 3300027902|Ga0209048_10000004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 195745 | Open in IMG/M |
| 3300027902|Ga0209048_10036741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4099 | Open in IMG/M |
| 3300027902|Ga0209048_10054559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3239 | Open in IMG/M |
| 3300027903|Ga0209488_10710262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300027905|Ga0209415_10194188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1931 | Open in IMG/M |
| 3300027908|Ga0209006_10008285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9396 | Open in IMG/M |
| 3300027908|Ga0209006_10481400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1037 | Open in IMG/M |
| 3300027908|Ga0209006_10655339 | Not Available | 863 | Open in IMG/M |
| 3300027908|Ga0209006_11170828 | Not Available | 602 | Open in IMG/M |
| 3300027910|Ga0209583_10323844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
| 3300027911|Ga0209698_10225180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1507 | Open in IMG/M |
| 3300027911|Ga0209698_11072401 | Not Available | 598 | Open in IMG/M |
| 3300028047|Ga0209526_10014255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5499 | Open in IMG/M |
| 3300028047|Ga0209526_10890037 | Not Available | 542 | Open in IMG/M |
| 3300028719|Ga0307301_10299723 | Not Available | 527 | Open in IMG/M |
| 3300028906|Ga0308309_11536923 | Not Available | 568 | Open in IMG/M |
| 3300030620|Ga0302046_10980404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300031057|Ga0170834_108672157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 865 | Open in IMG/M |
| 3300031226|Ga0307497_10229003 | Not Available | 820 | Open in IMG/M |
| 3300031231|Ga0170824_105124620 | Not Available | 549 | Open in IMG/M |
| 3300031234|Ga0302325_12039043 | Not Available | 706 | Open in IMG/M |
| 3300031241|Ga0265325_10000029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 103942 | Open in IMG/M |
| 3300031274|Ga0307442_1096801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 862 | Open in IMG/M |
| 3300031446|Ga0170820_12638944 | Not Available | 649 | Open in IMG/M |
| 3300031474|Ga0170818_110623426 | Not Available | 588 | Open in IMG/M |
| 3300031547|Ga0310887_10669281 | Not Available | 642 | Open in IMG/M |
| 3300031708|Ga0310686_102244047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 24124 | Open in IMG/M |
| 3300031708|Ga0310686_104044393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 29287 | Open in IMG/M |
| 3300031708|Ga0310686_107186296 | Not Available | 505 | Open in IMG/M |
| 3300031708|Ga0310686_107373175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp. | 1156 | Open in IMG/M |
| 3300031708|Ga0310686_117068399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1376 | Open in IMG/M |
| 3300031708|Ga0310686_117992625 | Not Available | 986 | Open in IMG/M |
| 3300031740|Ga0307468_102211461 | Not Available | 532 | Open in IMG/M |
| 3300031744|Ga0306918_10877507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300031753|Ga0307477_10001938 | Not Available | 16446 | Open in IMG/M |
| 3300031753|Ga0307477_10100228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 2014 | Open in IMG/M |
| 3300031754|Ga0307475_10346878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1193 | Open in IMG/M |
| 3300031823|Ga0307478_11070105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300031823|Ga0307478_11537196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300031908|Ga0310900_11318116 | Not Available | 604 | Open in IMG/M |
| 3300031910|Ga0306923_12468390 | Not Available | 513 | Open in IMG/M |
| 3300031949|Ga0214473_10081578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3783 | Open in IMG/M |
| 3300031949|Ga0214473_11227027 | Not Available | 774 | Open in IMG/M |
| 3300031949|Ga0214473_11804672 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300032061|Ga0315540_10274935 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium | 704 | Open in IMG/M |
| 3300032094|Ga0318540_10383683 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300032160|Ga0311301_10169865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3857 | Open in IMG/M |
| 3300032160|Ga0311301_10223592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3168 | Open in IMG/M |
| 3300032160|Ga0311301_10366344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2238 | Open in IMG/M |
| 3300032160|Ga0311301_10940722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1156 | Open in IMG/M |
| 3300032160|Ga0311301_11763303 | Not Available | 740 | Open in IMG/M |
| 3300032160|Ga0311301_11765889 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 739 | Open in IMG/M |
| 3300032160|Ga0311301_11816450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300032174|Ga0307470_10142625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1452 | Open in IMG/M |
| 3300032174|Ga0307470_10306572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1080 | Open in IMG/M |
| 3300032174|Ga0307470_10618154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 813 | Open in IMG/M |
| 3300032180|Ga0307471_101166680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 935 | Open in IMG/M |
| 3300032261|Ga0306920_101211265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1090 | Open in IMG/M |
| 3300032756|Ga0315742_13361132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300033004|Ga0335084_10268070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1768 | Open in IMG/M |
| 3300033486|Ga0316624_10015794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4071 | Open in IMG/M |
| 3300033887|Ga0334790_004379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9344 | Open in IMG/M |
| 3300033887|Ga0334790_198528 | Not Available | 577 | Open in IMG/M |
| 3300033888|Ga0334792_000440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 30591 | Open in IMG/M |
| 3300034090|Ga0326723_0190778 | Not Available | 907 | Open in IMG/M |
| 3300034124|Ga0370483_0224628 | Not Available | 641 | Open in IMG/M |
| 3300034149|Ga0364929_0202413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300034155|Ga0370498_063852 | Not Available | 829 | Open in IMG/M |
| 3300034158|Ga0370507_0275738 | Not Available | 558 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.26% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.70% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.01% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.79% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.34% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.12% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.12% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.57% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.57% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.67% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.67% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.67% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.67% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.45% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.45% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.45% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.45% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.45% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.45% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.22% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.22% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.22% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.22% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.22% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.22% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.22% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.22% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.22% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.22% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.22% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.22% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.22% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.22% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.22% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.22% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.22% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.22% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.22% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.22% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2124908028 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2140918024 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001385 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012077 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ013 MetaG | Host-Associated | Open in IMG/M |
| 3300012150 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ029 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012227 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2 | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015160 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022889 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026220 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031274 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
| 3300034158 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_02086760 | 2065487018 | Soil | PSTVNLYQIGVWFCVGFFTGAGWAVAAWLVGRILRF |
| P1_DRAFT_00325050 | 2088090004 | Soil | MPSTINLQLILVWFCVGFFTGAGWAIAAWLVGRILSVI |
| P1_DRAFT_00349730 | 2088090004 | Soil | MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFS |
| P3_DRAFT_00618690 | 2088090008 | Soil | MPSTITLYLIGVWFCVGFFTGAGWAIAAWLVGRIGSKVA |
| GPICI_03308240 | 2088090015 | Soil | MPSKIDLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI |
| beta3_all_01133800 | 2124908028 | Soil | MPSTINLQLILVWFCVGFFTGAGWAIAASLVGRILSVI |
| A2_c1_00708740 | 2124908043 | Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRILRF |
| KansclcFeb2_04403050 | 2124908045 | Soil | MPSTVTLYLIGVWFCVGFFTGAGWSIAAWLVGRILRF |
| P1_C_01050930 | 2140918006 | Soil | MPSTINLQLILVWFCVGFFTGAGWAIAAWLVGRIFSVI |
| B_all_v_00352150 | 2140918024 | Soil | STMPSTINLQLILVWFCVGFFTGAGWAIAATLVGRILSVI |
| B_all_v_02222730 | 2140918024 | Soil | MPSKIDIYQIGVWFCVGFFTSAGWALAAWLVGRILG |
| E1_02421900 | 2170459002 | Grass Soil | MPSTINLYLIGVWSAVGFFTGAGWAFAGWLVGRIFSHI |
| E4A_10645650 | 2170459003 | Grass Soil | MPSTINLYQIGVWFCVGFFTGAGWALGAWLVGRIFSHI |
| F47_05724320 | 2170459009 | Grass Soil | MPTTVSLYLVGVWFCVGFFTGAGWAIAGWLVGRVLARI |
| FE1_07231270 | 2189573002 | Grass Soil | MPSKIDLYQIGVWFCVGFFTGAGWAVAGWLVGRIFSAI |
| ICChiseqgaiiDRAFT_06710292 | 3300000033 | Soil | MPSKIDLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI* |
| JGI12270J11330_100227692 | 3300000567 | Peatlands Soil | MPSTVNLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV* |
| JGI12270J11330_101702752 | 3300000567 | Peatlands Soil | MPSTVNLYQIGVWFCVGLFTGAGWAIAAFLVGRILSAV* |
| JGI12270J11330_101922222 | 3300000567 | Peatlands Soil | MPSNINLYQIGVWFCVGFFTGAGWAIAALLVGRILSAV* |
| JGIcombinedJ13530_1008152393 | 3300001213 | Wetland | MPTTVTLYQISVWCCVGFFTGAGWAFGAWIVARLLRSA* |
| JGI20193J14888_10245342 | 3300001385 | Arctic Peat Soil | MPSTINVQLIGVWFCVGFFTGAGWAIAAWLVGRILSAI* |
| JGI12712J15308_100212932 | 3300001471 | Forest Soil | MPSTINIHLIGVWFCVGFFTGAGWAIAAWLVARILTAL* |
| JGI12635J15846_104058862 | 3300001593 | Forest Soil | MPATVSLYLIGVWFCVGFFTGAGWAIATWLVGRTLSRI* |
| JGI12635J15846_106701682 | 3300001593 | Forest Soil | GSTMPSTINLYQIGVWFCVGFFTGAGWAVAAVLVGRILSAV* |
| JGIcombinedJ26739_1000738503 | 3300002245 | Forest Soil | MPSTVNLYQIGVWFCVGFFTGAGWAIASVIVGRIFAHI* |
| JGIcombinedJ26739_1002292781 | 3300002245 | Forest Soil | MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILGIIHI* |
| JGIcombinedJ26739_1004661983 | 3300002245 | Forest Soil | MPSTVNLYLVGVWFCVGFFTGAGWAVAAWLVGRILSII |
| JGIcombinedJ26739_1011561131 | 3300002245 | Forest Soil | MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSVV* |
| JGIcombinedJ26739_1013251142 | 3300002245 | Forest Soil | MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSTI* |
| JGIcombinedJ26739_1016954351 | 3300002245 | Forest Soil | MEIDMPMTITLYLIGVWFCVGFFAGAGWTLAAHLIGRLL* |
| Ga0031654_1000007112 | 3300003861 | Freshwater Lake Sediment | MPTTISLYQFGIWFCVGFSTGAGWTIAAWLVGRIGTKVA* |
| Ga0058891_14647481 | 3300004104 | Forest Soil | NMPSTINLHQIGVWFCVGFFTGAGWAFAAWLIGRIFSHI* |
| Ga0062388_1005085772 | 3300004635 | Bog Forest Soil | MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI* |
| Ga0062594_1005419282 | 3300005093 | Soil | MPVTVTLYLIGVWFCVGFFTGAGWAIASWLVGRVGSRVG* |
| Ga0062594_1011710802 | 3300005093 | Soil | MPSNINLYQIGVWFCVGFFTGSGWAIAAWLVGRVLGRLI* |
| Ga0066388_1008448832 | 3300005332 | Tropical Forest Soil | MPTAINLTLIGVWFCVGFFAGAGWAIAAWLVGRTLGRLA* |
| Ga0066388_1018155171 | 3300005332 | Tropical Forest Soil | MPSTVNLNLIGVWFCVGFFTGAGWAIAAWLVGRVLGHII* |
| Ga0066388_1029720752 | 3300005332 | Tropical Forest Soil | MPSIVNLKLIGIWFCVGFFTGAGGAIAAWLVGRTLGRLV* |
| Ga0070711_1016683551 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTKVNLELIMVWFCVGFFTGAGWAVATWLVGRILGLTHL* |
| Ga0070741_1000140131 | 3300005529 | Surface Soil | VPATITPYLIGVWFCVGFFTGCGWALALWLVGRLLARF* |
| Ga0070679_1021476561 | 3300005530 | Corn Rhizosphere | MPSTISLPLIGIWFCVGFFTGLGWFVAGRILEGYSNGYVQ |
| Ga0070734_1000096256 | 3300005533 | Surface Soil | MPSKIDLHLIGIWFCVGFFTGAGWAIATWLVGRILSVI* |
| Ga0070730_104302761 | 3300005537 | Surface Soil | MPSTVNLYLVGVWFCVGFFTGAGWATATWLVGRILSIIHI* |
| Ga0070733_1000035511 | 3300005541 | Surface Soil | MPSTVNLYLIGVWFCVGFFTGAGWATAAWLVGRILSIIHI* |
| Ga0070733_100023348 | 3300005541 | Surface Soil | MPSTVNLHLIGVWFCVGFFTGAGWAAATWLVGRIISFI* |
| Ga0070732_100890502 | 3300005542 | Surface Soil | MPSTINLHQIGVWFCVGFFTGAGWAFAAWLIGRIFSHI* |
| Ga0070732_102153802 | 3300005542 | Surface Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAVLVGRILAAV* |
| Ga0070672_1018431952 | 3300005543 | Miscanthus Rhizosphere | MPSNINLYQIGVWFCVGFFTGSGWAIAAWLVGRVLG |
| Ga0066661_100534332 | 3300005554 | Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHV* |
| Ga0066700_108407142 | 3300005559 | Soil | TINLRLIGIWFCVGFFTGAGWAIAALLVSRLLGRF* |
| Ga0066694_101498212 | 3300005574 | Soil | MPSTINLRLIGIWFCVGFFTGAGWSIAALIVSRLLGRL* |
| Ga0070761_100704091 | 3300005591 | Soil | MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAI* |
| Ga0070761_101618415 | 3300005591 | Soil | MPSTINLYQIGVWFCVGFFTGAGWAVAAVLVGRILSAV* |
| Ga0070762_104212722 | 3300005602 | Soil | MPSTVNPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI* |
| Ga0070762_107603802 | 3300005602 | Soil | MPSTINIHLIGVWFCVGFFTGAGWAIAAWLVARILTAI* |
| Ga0068859_1000044403 | 3300005617 | Switchgrass Rhizosphere | MPTAVTIYNLGVWFCVGLFTSLGWSCGAWLVSRVLR* |
| Ga0068866_101201942 | 3300005718 | Miscanthus Rhizosphere | MPSTVNLHQIGVWFCVGFFTGAGWAIAAWLVGRILRF* |
| Ga0066903_1001126956 | 3300005764 | Tropical Forest Soil | MPSTINLQQIGVWFCVGFFTGAGWALAAWLVGRIFTHI* |
| Ga0066903_1021068993 | 3300005764 | Tropical Forest Soil | MPSTVNLNLIGVWFCVGFFTGAGWAIASWLVGRVLGHII* |
| Ga0066903_1064700781 | 3300005764 | Tropical Forest Soil | MPSKINLYQIGVWFCVGFFTSAGWAIAALLVGRILSAV* |
| Ga0066903_1088024362 | 3300005764 | Tropical Forest Soil | MLSKNNLYQIGVWFCVGFFTSADWAIAALLVGRILSAV* |
| Ga0074472_101246464 | 3300005833 | Sediment (Intertidal) | MPSTINLYQIGVWSCVGFFTGAGWAIAAWIVGRILRF* |
| Ga0070766_108332192 | 3300005921 | Soil | INLYQIGVWFCVGFFTGAGWAVAAVLVGRILSAV* |
| Ga0070766_112859351 | 3300005921 | Soil | MPSTVNVYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI* |
| Ga0066795_100142693 | 3300005938 | Soil | MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFSII* |
| Ga0066795_100896252 | 3300005938 | Soil | MPSTINLQLILVWFCVGFFTGAGWAIAASLVGRILSVI* |
| Ga0066795_101700003 | 3300005938 | Soil | MPSTVNLQLILVWFCVGFFTGAGWAIAAWLVGRILSVI* |
| Ga0066795_102418542 | 3300005938 | Soil | MPSKIDIYQIGVWFCVGFFTSAGWALAAWLVGRILGFTHI* |
| Ga0066794_102233602 | 3300005947 | Soil | MPMTITLYLLGVWFCVGFFTGAGWFIASWLVTRLLSKLA* |
| Ga0081540_10000655 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MPTNINPRLIGIWFCVGFFTGAGWAIAAWLVGRVFSHI* |
| Ga0066789_102042272 | 3300005994 | Soil | MPSTINLQLILVWFCVGFFTGAGWAIAATFVGRILSVI* |
| Ga0070717_103499433 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSTVNAYLIGVWFCVGFFTGAGWAVAAWLVGRILSAI* |
| Ga0075365_103258122 | 3300006038 | Populus Endosphere | MPSTVNLYLIGVWFCVGFFTGAGWSIAAWLVGRILRF* |
| Ga0075365_104686352 | 3300006038 | Populus Endosphere | MPATVNLYLIGVWFCVGFFTGAGWSIAAWLVGRILRF* |
| Ga0075023_1001693443 | 3300006041 | Watersheds | MPSAVNVYLIGVWFCVGFFTGAGWAVAAWLVGRILNAI* |
| Ga0066652_1004556572 | 3300006046 | Soil | MPMAINLKLIGVWFCVGFFTGAGWAIAAWLVGRTLGRFV* |
| Ga0075024_1008260001 | 3300006047 | Watersheds | MPSTISLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV* |
| Ga0075028_1000360712 | 3300006050 | Watersheds | MPSTVNLYLIGVWFCVGFFTGSGWAVAAWLVGRILSIIHI* |
| Ga0075028_1007973731 | 3300006050 | Watersheds | MPSKIDLYQIGVWFCVGFFTGAGWAVAAWLVGRIFSAI* |
| Ga0075029_1004570892 | 3300006052 | Watersheds | MPSTINLYQIGVWFCVGFFTGAGWAIAALLVGRIFSTV* |
| Ga0097691_10082665 | 3300006055 | Arctic Peat Soil | MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRILSAI* |
| Ga0097691_10160092 | 3300006055 | Arctic Peat Soil | MPSTVNLYLIGVWFCVGFFTGAGWAIATWLVGRIIFFI* |
| Ga0097691_10172738 | 3300006055 | Arctic Peat Soil | MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSFIHI* |
| Ga0097691_10860523 | 3300006055 | Arctic Peat Soil | MPSTINLQLILVWFCVGFFTGAGWAIAATLVGRILSVI* |
| Ga0075432_103543151 | 3300006058 | Populus Rhizosphere | TVNLYLIGVWFCVGFFTGAGWSIAAWLVGRILRF* |
| Ga0075019_101541503 | 3300006086 | Watersheds | MPSTINLYQIGVWFCVGFFTGAGWAIAALIVGRIFSAV* |
| Ga0075019_108667611 | 3300006086 | Watersheds | NMPSTVNLYLIGVWFCVGFFTGAGWAIATWLVGRIIFFV* |
| Ga0075030_1002253912 | 3300006162 | Watersheds | MPSTINPYLIGVWFCVGFFTGAGWAVAAWLVGRVLSAI* |
| Ga0075018_102306501 | 3300006172 | Watersheds | KIDVYQIGVWFCVGFFTGAGWAVAGWLVGRIFSAI* |
| Ga0075018_103719851 | 3300006172 | Watersheds | NLYLIGVWFCVGFFTGAGRAVAAWLVGRILSIIHI* |
| Ga0075014_1000280021 | 3300006174 | Watersheds | ESNMPSTINLYQIGVWFCVGFFTGAGWAIAALIVGRIFSAV* |
| Ga0075014_1008980142 | 3300006174 | Watersheds | MPSKIDVYQIGVWFCVGFFTGAGWAIAAWLVARILTAI* |
| Ga0070765_1003269323 | 3300006176 | Soil | MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRVFSAI* |
| Ga0070765_1006313003 | 3300006176 | Soil | MPSTVNPYLLGVWFCVGSFTGAGWAVAAWLVGRILSYIHI* |
| Ga0070765_1006698022 | 3300006176 | Soil | MPSNINLYQIGVWFCVGFFTGAGWAIASVIVGRIFAHI* |
| Ga0070765_1013708202 | 3300006176 | Soil | MPSKIDVYLIGVWFCVGFFTGAGWAIAGWLVGRIFAAI* |
| Ga0075021_100127104 | 3300006354 | Watersheds | MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSLIHI* |
| Ga0075522_100080932 | 3300006638 | Arctic Peat Soil | MPTKLNLELIDVWFCVGFFTGAGWAVAAWLVGRIFSAI* |
| Ga0075520_10373623 | 3300006795 | Arctic Peat Soil | MPTKLNLELIGVWFCVGFFTGAGWAVATWLVGRIFSAI* |
| Ga0066660_103725433 | 3300006800 | Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLAGRIFSHV* |
| Ga0075464_100463583 | 3300006805 | Aqueous | MPNTITLYQIGVWCCVGFFTGAGWTLGAWLIARILR* |
| Ga0075464_100958973 | 3300006805 | Aqueous | MPNTITLYQIGVWCCVGFFTGACWTLGARFIARILR* |
| Ga0075464_107147302 | 3300006805 | Aqueous | MPNTITLYQIGVWCCVGFFTGAGWALGAWLIARILR* |
| Ga0075464_109907122 | 3300006805 | Aqueous | MPNEITLYLIGVWCCVGLFTGAGWALGSWIVGRLLR* |
| Ga0075464_110500922 | 3300006805 | Aqueous | MPATISLYLIGVWFCVGFFTGCGWALALWLVGRILSRV* |
| Ga0075428_1011836061 | 3300006844 | Populus Rhizosphere | MPSTITLYQIGVWFCVGFFTGAGWAIAAWLVGRILRF* |
| Ga0075425_1000338266 | 3300006854 | Populus Rhizosphere | MPSIVNVYLIGVWFCVGFFTGAGWAIAAWLVGRIFSHI* |
| Ga0075425_1003564172 | 3300006854 | Populus Rhizosphere | MPNTITLYQVGVWTAVGFFTGAGWTLGAWLVARILR* |
| Ga0075425_1024915942 | 3300006854 | Populus Rhizosphere | TINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI* |
| Ga0066797_11107212 | 3300006864 | Soil | MPSKIDIYQIGVWFCVGFFTSAGWAFAAWLVGRILGFTHI* |
| Ga0075434_1013753642 | 3300006871 | Populus Rhizosphere | MPSKIDLYQIGVWFCVGFFTGAGWAVAAWLVGRIFSHI* |
| Ga0075434_1017512752 | 3300006871 | Populus Rhizosphere | MPSAVNLRLIGVWFCVGFFTGAGWAIAAWLVGRVLRF* |
| Ga0075434_1025379741 | 3300006871 | Populus Rhizosphere | MPSTVNLYLIGVWFCVGFFTGAGWSIAAWIVGRILRF |
| Ga0073928_101925102 | 3300006893 | Iron-Sulfur Acid Spring | MPSTINPRLIGVWFCVGFFTGAGWAIAAWLVGRILSAI* |
| Ga0073928_107301912 | 3300006893 | Iron-Sulfur Acid Spring | MPSTINLYQIGVWFCVGFFTGAGWAVAAVLVGRILSVV* |
| Ga0073928_109866482 | 3300006893 | Iron-Sulfur Acid Spring | MPSTVAPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI* |
| Ga0075424_1020538221 | 3300006904 | Populus Rhizosphere | MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI* |
| Ga0079303_100547014 | 3300006930 | Deep Subsurface | MPTTVTLYQIGVWFCVGFFTGVGWALGSWVVARILR* |
| Ga0075524_105401722 | 3300006950 | Arctic Peat Soil | MPGESTMPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRILSLI* |
| Ga0099793_103502031 | 3300007258 | Vadose Zone Soil | MPSVVNVYLIGVWFCVGFFTGAGWAIAAWLVGRIFSHI* |
| Ga0099793_107182381 | 3300007258 | Vadose Zone Soil | MPSTINLHQIGIWFCVGFFTGAGWALAAWLVGRIFSHI* |
| Ga0099794_104902452 | 3300007265 | Vadose Zone Soil | MPITVSLYLIGVWFCVGFFTGAGWAIAAWLVGRLLSRF* |
| Ga0099795_100145382 | 3300007788 | Vadose Zone Soil | MPSTVTPYLIGVWFCVGFFPGAGWAVAAWLVGRILSYIHI* |
| Ga0102924_100034247 | 3300007982 | Iron-Sulfur Acid Spring | MPSTINLYQIGVWFCVGFFTGAGWAIAGFLVARILTAV* |
| Ga0066793_100752535 | 3300009029 | Prmafrost Soil | MPGESTMPSTINLQLILVWFCVGFFTGAGWAIAATLVGRILSVI* |
| Ga0099829_101411861 | 3300009038 | Vadose Zone Soil | MPSTINLYQIGVWFCVGFFTGAGWALAAWLVGRIFSHI* |
| Ga0099829_102393392 | 3300009038 | Vadose Zone Soil | MPSTINLYQIGVWAAVGFFTGAGWAFAGWLVGRIFSHI* |
| Ga0105095_105042411 | 3300009053 | Freshwater Sediment | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRILRF* |
| Ga0099830_100547765 | 3300009088 | Vadose Zone Soil | MPITVSLYLIGVWFCVGFFTGAGWAIAAWLVGRLLSRL* |
| Ga0099828_100130895 | 3300009089 | Vadose Zone Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI* |
| Ga0099827_1000022013 | 3300009090 | Vadose Zone Soil | MPSTINLHQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI* |
| Ga0099827_104532162 | 3300009090 | Vadose Zone Soil | MPSIVNVYLIGVWFCVGFFTGAGWALAAWLVGRIFSHI* |
| Ga0105245_1000053112 | 3300009098 | Miscanthus Rhizosphere | MPSTLTPYALLVWFCVGLFTGLGWACGAWLVGRILK* |
| Ga0066709_1011368192 | 3300009137 | Grasslands Soil | MPSTVNLYQIGVWSAVGFFTGAGWAFAGWLIGRIFSHI* |
| Ga0105243_1000043022 | 3300009148 | Miscanthus Rhizosphere | MPETVSLYAIGVWCCVGFFTGAGWSLGAWVIGRLLR* |
| Ga0111538_100507156 | 3300009156 | Populus Rhizosphere | MPSTVNLYQIGVWFCVGFFTGAGWAVASWLVGRIFSHI* |
| Ga0111538_102597613 | 3300009156 | Populus Rhizosphere | MPSTISLYVIGVWFAVGVFTGAGWAVGTWIVAKLTR* |
| Ga0075423_118678762 | 3300009162 | Populus Rhizosphere | MPSTINLQLIGVWFCVGFFTGAGWAIAAWIVGRVLRF* |
| Ga0075423_123666332 | 3300009162 | Populus Rhizosphere | MPSTINAYQIGVWFCVGFFTGAGWALAAWLVGRIFSHI* |
| Ga0105241_1000027263 | 3300009174 | Corn Rhizosphere | MPETVTLYGIGVWTCVGFFTGAGWALASWLVSRITR* |
| Ga0105242_101204474 | 3300009176 | Miscanthus Rhizosphere | MPTTITLYQLGVWTAVGFFTGAGWTLGAWLVARILR* |
| Ga0105242_101215224 | 3300009176 | Miscanthus Rhizosphere | MPTTITLYQIGVWTAVGFFTGAGWTLGAWLVARILR* |
| Ga0105242_109016802 | 3300009176 | Miscanthus Rhizosphere | MPSSINLRLIGVWFCVGFFTGAGWAIAAWLVGRVLRF* |
| Ga0116214_13651881 | 3300009520 | Peatlands Soil | NMPSIVNLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV* |
| Ga0116218_15385782 | 3300009522 | Peatlands Soil | GESNMPSTINLYQIGVWCAVGFFTGVGWAFAGWLVGRIFSHI* |
| Ga0116221_10673515 | 3300009523 | Peatlands Soil | MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRILSVV* |
| Ga0116220_100256701 | 3300009525 | Peatlands Soil | MPSTVNLYLIGVWFCVGFFTSAGWALAAWLVGRILSAV* |
| Ga0105249_119646862 | 3300009553 | Switchgrass Rhizosphere | MPSAVNLYQIGVWFCVGFFTGAGWATAAWLVGRILRF* |
| Ga0116110_11716901 | 3300009643 | Peatland | MPSKIDIYQIGVWFCVGFFTGAGWAIAGWLVGRILSVV* |
| Ga0105857_10239722 | 3300009650 | Permafrost Soil | MPATVSLYLIGVWFCVGFFTGAGWAIAAWLVGRTLSRI* |
| Ga0105857_10829211 | 3300009650 | Permafrost Soil | MPSKIDLYLIGVWFCVGFFTGAGWAIAAWLVGRILSAI* |
| Ga0105856_11048162 | 3300009662 | Permafrost Soil | MPAKIDLYQIGVWFCVGFFTGAGWAIATWLVGRIFTAI* |
| Ga0116216_109552232 | 3300009698 | Peatlands Soil | ESNMPSTVNLYLIGVWFCVGFFTSAGWALAAWLVGRILSAV* |
| Ga0116217_100420545 | 3300009700 | Peatlands Soil | MPSTVNLYLIGVWFCVGFFTGAGWATATWLVGRILSIIHI* |
| Ga0116134_10752882 | 3300009764 | Peatland | MPSTINLYQIGVWFCVGFFTGAGWAIAALLVGRILSAV* |
| Ga0105067_10714351 | 3300009812 | Groundwater Sand | LVTQGESNMPSTINLYQIGVWFCVGFFTGAGWAIAAWIVGRILRF* |
| Ga0105087_10143322 | 3300009819 | Groundwater Sand | MPSTINLYQIGVWFCVGFFTGAGWAIAAWIVGRILRF* |
| Ga0116223_105457292 | 3300009839 | Peatlands Soil | MPSTINLYQIGVWFCVGFFTGAGWAIATVLVGRLLSAV* |
| Ga0116223_107531741 | 3300009839 | Peatlands Soil | MPSKIDIYQIGVWFCVGFFTGAGWAIAGWLVGRIISVV* |
| Ga0126384_123387171 | 3300010046 | Tropical Forest Soil | MPSTVNLNLIGVWFCVGFFTGAGWAIAAWLVGRILGHVL* |
| Ga0074044_107483871 | 3300010343 | Bog Forest Soil | MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAV* |
| Ga0126372_116068532 | 3300010360 | Tropical Forest Soil | MMNLILRGFMPSIVNLKLIGIWFCVGFFTGAGGAIAAWLVGRTLGRLV* |
| Ga0126381_1005420071 | 3300010376 | Tropical Forest Soil | MPTKIDLYQIGVWFCVGFFAGAGWAIAGSLVGRIFSAV* |
| Ga0126381_1013714372 | 3300010376 | Tropical Forest Soil | MPSKINPYQIGVWFCVGFFTSAGWAIAALLVGRILSPV* |
| Ga0136449_10004375012 | 3300010379 | Peatlands Soil | MPSTINLYQIGVWCAVGFFTGVGWAFAGWLVGRIFSHI* |
| Ga0136449_1003355954 | 3300010379 | Peatlands Soil | MPSIVNLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV* |
| Ga0136449_1004102083 | 3300010379 | Peatlands Soil | MPSTINLYQIGVWCCVGFFTGAGWAFAAWLVGRIFSHI* |
| Ga0136449_1006828242 | 3300010379 | Peatlands Soil | MPSAINLYQIGVWFSVGFFTGAGWAVAAWLVGRVLTAI* |
| Ga0136449_1007031272 | 3300010379 | Peatlands Soil | MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRVLAAI* |
| Ga0136449_1008798282 | 3300010379 | Peatlands Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAVLVGRILSAV* |
| Ga0136449_1016929703 | 3300010379 | Peatlands Soil | MPSTVNLYQIGVWFCVGFFTGAGWAIAALLVGRTFSAV* |
| Ga0136449_1019834963 | 3300010379 | Peatlands Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSVV* |
| Ga0136449_1032666411 | 3300010379 | Peatlands Soil | MPSTINLYQIGVWCAVGFFTGAGWAFAAWLVGRIFSHI* |
| Ga0136449_1043662501 | 3300010379 | Peatlands Soil | STINLYQIGVWFCVGFFTGAGWAVAAVLVGRILSAV* |
| Ga0134122_119974641 | 3300010400 | Terrestrial Soil | MPDTVSLYAIGVWCCVGCFTGAGWSFGAWVIGRLCR* |
| Ga0134121_113447421 | 3300010401 | Terrestrial Soil | MPNTIGWMQAGIWCAVGFCVGAGWTLGAWLVARILR* |
| Ga0134123_100011207 | 3300010403 | Terrestrial Soil | MPNTITLYQVGVWVSVGFFTGAGWALGSWIVARILR* |
| Ga0134123_123899032 | 3300010403 | Terrestrial Soil | MPSSINLRLIGVWFCVGFFTGAGWVIAAWLVGRVLRF* |
| Ga0126350_100275812 | 3300010880 | Boreal Forest Soil | MPSTINPRLIGVWFCVGFFTGAGWAIAAWLVTRILTAI* |
| Ga0150983_129480072 | 3300011120 | Forest Soil | MPSNINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI* |
| Ga0150983_132705302 | 3300011120 | Forest Soil | MPSTINLYQIGVWFCVGFFTGAGWAVATVIVGRILSAI* |
| Ga0150983_135582604 | 3300011120 | Forest Soil | MPSTVNPYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI* |
| Ga0150983_154444802 | 3300011120 | Forest Soil | MPSNINLYQIGVWFCVGFFTGAGWAVAAWLVGRIFSAL* |
| Ga0137392_114136261 | 3300011269 | Vadose Zone Soil | SQGESNMPSIVNVYLIGVWFCVGFFTGAGWAIAAWLVGRIFSHI* |
| Ga0137393_107340451 | 3300011271 | Vadose Zone Soil | TINLYQIGVWFCVGFFTGAGWALAAWLVGRIFSHI* |
| Ga0137440_11371882 | 3300011410 | Soil | MPSTITLYLIGVWFCVGFFTGAGWAIAAWLVGRILSRI* |
| Ga0137462_10066864 | 3300011421 | Soil | MPSTITLYEIGVWFAVGFFTGAGWALASWIVNRIFR* |
| Ga0137443_10100053 | 3300011433 | Soil | MPSKINVYQIGVWFCVGFFTGAGWAVAAWLVGRIFSRI* |
| Ga0137463_10823122 | 3300011444 | Soil | MPSTVTLYQIGVWCCVGFFTGAGWTCGAWVISRLLR* |
| Ga0153929_10517373 | 3300012077 | Attine Ant Fungus Gardens | MPSTINPYQIGVWFCVGFFTGAGWAIASLLVGRIFSAI* |
| Ga0153945_10615732 | 3300012150 | Attine Ant Fungus Gardens | MPSTINLYQIGVWFCVGFFTGAGWAIASVIVGRILSVI* |
| Ga0137388_100737884 | 3300012189 | Vadose Zone Soil | MPATVSLYLIGVWFCVGFVTGAGWAIAAWLVGRLLSRF* |
| Ga0137388_106694341 | 3300012189 | Vadose Zone Soil | MPSIVNFYLFGVWFCVGFFTGAGWAIAAWLVGRIFSHI* |
| Ga0137363_113889842 | 3300012202 | Vadose Zone Soil | STVNLYQIGVWSAVGFFTGAGWAFAGWLIGRIFSHI* |
| Ga0137362_108731792 | 3300012205 | Vadose Zone Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLIGRIFSSI* |
| Ga0137379_100391976 | 3300012209 | Vadose Zone Soil | MPSTINLRLIGIWFCVGFFTGAGWAIAALLVSRLLGRF* |
| Ga0137377_101710494 | 3300012211 | Vadose Zone Soil | MPSKIDLYQIGVWFCVGFFTGAGWAVAGWLVGRIFSAI* |
| Ga0137449_11543511 | 3300012227 | Soil | MPSKIDVYQIGVWFCVGFFTGAGWAIAAWLVGRILSRI* |
| Ga0137435_11033252 | 3300012232 | Soil | MPTKLDVNLIAVWFCVGFFTGAGWAIAAWLVGRIFSHI* |
| Ga0137369_102871263 | 3300012355 | Vadose Zone Soil | MPTAVNLKLIGVWFCVGFFTGAGWAIAAWLVGRTLGRLI* |
| Ga0137384_113598971 | 3300012357 | Vadose Zone Soil | MPAKIDVYQIGVWFCVGFFTGAGWAVAGWLVGRIFSAI* |
| Ga0137360_112244271 | 3300012361 | Vadose Zone Soil | MPSTINLYQIGVWCAVGFFTGAGWAFAGWLVGRIFSHI* |
| Ga0137390_105431464 | 3300012363 | Vadose Zone Soil | MPTIVSLYLIGVWFCVGFFTGAGWAIAAWLVGRLLSRF* |
| Ga0137390_105489622 | 3300012363 | Vadose Zone Soil | MPAIVSLYLIGVWFCVGFFTGAGWALAAWLVGRILSHA* |
| Ga0137398_104047821 | 3300012683 | Vadose Zone Soil | TVTPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI* |
| Ga0137397_100707752 | 3300012685 | Vadose Zone Soil | MPSTVTPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI* |
| Ga0137397_110966401 | 3300012685 | Vadose Zone Soil | KGESNMPTTVNLQLIGVWFCVGFFAGAGWAVAAWLVARTLGRLL* |
| Ga0137395_104666141 | 3300012917 | Vadose Zone Soil | MPSTINLYQIGVWSAVGFFTGAGWAFAGWLIGRIFSHI* |
| Ga0137359_113005922 | 3300012923 | Vadose Zone Soil | MPSTINLHQIGVWFCVGFFTGAGWAIAAWLIGRIFSSI* |
| Ga0137359_117599901 | 3300012923 | Vadose Zone Soil | MPSTVNLYQIGVWAAVGFFTGAGWAFAGWLVGRIFSHI* |
| Ga0137407_114178911 | 3300012930 | Vadose Zone Soil | MPSTINVYQIGVWFCVGFFTGAGWAIAAWLVGRVLGRLV* |
| Ga0153915_119036471 | 3300012931 | Freshwater Wetlands | MPSKIDIYQIGVWFCVGFFTGAGWAIASWLVGRIFSAI* |
| Ga0137410_117658002 | 3300012944 | Vadose Zone Soil | MPTTVNLQLIGVWFCVGFFAGAGWAVATWLVARTLGRLL* |
| Ga0137410_119077281 | 3300012944 | Vadose Zone Soil | MPSTINVYQIGVWFCVGFFTGAGWAIAGWLVGRVLGRLV* |
| Ga0126375_105555812 | 3300012948 | Tropical Forest Soil | MPSTVNLNLIGVWFCVGFFTGAGWAIAAWLVGRVLGHVI* |
| Ga0126369_127086922 | 3300012971 | Tropical Forest Soil | GHFRETHMPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFTHI* |
| Ga0120127_100034684 | 3300013503 | Permafrost | MPSTINLQLILVWFCVGFFTGAGWAVATLLVGRILSVI* |
| Ga0120149_11601731 | 3300014058 | Permafrost | MPSTVNLYLIGVWFCVGFFTGAGGAIATWLVGRIC |
| Ga0181521_104104492 | 3300014158 | Bog | AYPQLIGVWFCVGFFTGAGWAIAAGLVGRILSVI* |
| Ga0181530_100187617 | 3300014159 | Bog | MPSTVNLYQIGVWFCVGFFTGAGWAVAAFLVGRILSAV* |
| Ga0181532_100635171 | 3300014164 | Bog | MPSTVNLYQIGVWFCVGFFTGAGWAIAGFLVARILTAV* |
| Ga0181532_102503683 | 3300014164 | Bog | MPSTLTPQLIGVWFCVGLFTGAGWAIAAGLVGRIMSVI* |
| Ga0181523_104790491 | 3300014165 | Bog | MPSKIDLYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAI* |
| Ga0181526_102202441 | 3300014200 | Bog | MPSKIDIYQIGVWFCVGFFTGAGWAIAGWLVGRIGGGR |
| Ga0181526_105428372 | 3300014200 | Bog | MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSIVHI* |
| Ga0182018_100233062 | 3300014489 | Palsa | MPSTINLYQIGVWFCVGFFTGSGWAIATVLVGRLLSAV* |
| Ga0182018_102492042 | 3300014489 | Palsa | MPSTVNPYLIGVWFCVGFFTGAGWAVATVIVGRVLSAI* |
| Ga0182018_102994572 | 3300014489 | Palsa | MPSTINLHQIGVWFCVGFFTGAGWAVAAWLVGRVLTAI* |
| Ga0182013_100654562 | 3300014492 | Bog | MPSTINLHLIGVWFCVGFFTGAGWAVATWLVGRIIFFI* |
| Ga0182015_102106052 | 3300014495 | Palsa | MPSTIKLYQIGVWFCVGFFTSAGWAIAALLVGRILSTVLTQTSEG* |
| Ga0182024_1000298143 | 3300014501 | Permafrost | MPSTVNLYLIGVWFCVGFFTGAGWTIAAWLVGRIFSIV* |
| Ga0182024_100402727 | 3300014501 | Permafrost | MPSTVNLYLIGVWFCVGFFTGAGWAIATWLVGRVIFFI* |
| Ga0182024_101749676 | 3300014501 | Permafrost | MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRILSAV* |
| Ga0182024_102584262 | 3300014501 | Permafrost | MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRILSVI* |
| Ga0182024_116270572 | 3300014501 | Permafrost | MPSTINLYQIGVWFCVGFFTGAGWAVAAWLVGRVLTAI* |
| Ga0181522_106699841 | 3300014657 | Bog | MPSTINLYQIGVWFCVGFFTGAGWAIASVLVGRLLSVI* |
| Ga0182030_109967733 | 3300014838 | Bog | MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFSVI* |
| Ga0180062_10057304 | 3300014879 | Soil | RMLPTVITLYSALVWVVVGFCVGAGWTLGAWIVARILRSA* |
| Ga0167639_10001342 | 3300015080 | Glacier Forefield Soil | MPTKFSLELIGVWFCVGFFTGAGWAVAAWLVGRVFSAI* |
| Ga0167642_10066512 | 3300015160 | Glacier Forefield Soil | MPSTVDLYLIGVWFCVGFFTGAGWAVAAWLVGRILGIIHI* |
| Ga0132258_104673783 | 3300015371 | Arabidopsis Rhizosphere | MPTKVNLELIIVWFCVGFFTGAGWAIATWLVGRILGLTHL* |
| Ga0182034_113177111 | 3300016371 | Soil | RHSRETHMPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFTHI |
| Ga0182034_119170082 | 3300016371 | Soil | MPTKIDLYQIGVWFCVGFFTSAGWATAGWLVGRIFSAFSAV |
| Ga0181515_10547601 | 3300016730 | Peatland | RINMPSTVNLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV |
| Ga0187802_100014586 | 3300017822 | Freshwater Sediment | MPSTINLYQIGVWFCVGFFTGAGWAIAALLVGRIFSTV |
| Ga0187818_103832031 | 3300017823 | Freshwater Sediment | MPSTINLYQIGVWCSVGFFTGAGWAFAGWLVGRIFSHI |
| Ga0187856_10164456 | 3300017925 | Peatland | MPSTINLYQIGVWFCVGFFTGAGWAIAAVLVGRILSAV |
| Ga0187856_10783201 | 3300017925 | Peatland | MPSNINLYQIGVWFCVGFFTGAGWAIAALLVGRILSAV |
| Ga0187824_101030361 | 3300017927 | Freshwater Sediment | MPSTINLYHIGVWFCVGFFTGAGWAIAALIVGRIFSAV |
| Ga0187853_100648753 | 3300017940 | Peatland | MPSTVNLYQIGVWFCVGLFTGAGWAIAAFLVGRILSAV |
| Ga0187879_105017372 | 3300017946 | Peatland | MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSVV |
| Ga0187817_100679041 | 3300017955 | Freshwater Sediment | ESNMPSTINLYQIGVWFCVGFFTGAGWAIAALLVGRIFSTV |
| Ga0187781_101376082 | 3300017972 | Tropical Peatland | MPSKIDLYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAI |
| Ga0187891_10374684 | 3300017996 | Peatland | MPSTINLYQIGVWFCVGFFTGAGWAIAAVLVGRILSIV |
| Ga0187872_100368993 | 3300018017 | Peatland | MPSKIDIYQIGVWFCVGFFTGAGWAIAGWLVGRILSVV |
| Ga0187874_103651962 | 3300018019 | Peatland | MPSTVNLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV |
| Ga0187857_103066941 | 3300018026 | Peatland | MPSTINLYQIGVWFCVGFFTGAGWAIAALLVGRILSAV |
| Ga0184605_100275292 | 3300018027 | Groundwater Sediment | MPSTINLRLIGIWFCVGFFTGAGWSIAALIVSRLLGRL |
| Ga0187869_105137111 | 3300018030 | Peatland | MPSTVNLYLIGVWFCVGFFTGAGWAIATWLVGRIIFFI |
| Ga0187887_104325141 | 3300018043 | Peatland | PSLPGEFNMPSIVNLQLIGVWFCVGFFTGAGWAVATWLVGRIIFFI |
| Ga0184623_101047803 | 3300018056 | Groundwater Sediment | SSSSPGESNMPATVNLYLLGVWFCVGFFTGSGWALAAWLVGRVLSRI |
| Ga0187858_104898642 | 3300018057 | Peatland | MPSNINLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV |
| Ga0190272_116850132 | 3300018429 | Soil | MPSAVNLYLIGVWFCVGFFTGAGWSIAAWLVGRILRF |
| Ga0190272_117990062 | 3300018429 | Soil | MGLVANSADGEINMPSTITLYLIGVWFCVGFFAGAGWTLAARIISRVL |
| Ga0066662_101138962 | 3300018468 | Grasslands Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLAGRIFSHV |
| Ga0190270_100919492 | 3300018469 | Soil | MPSTINLYLIGVWFCVGFFTGAGWAIAAWLVGRIFSHM |
| Ga0190270_106785653 | 3300018469 | Soil | MPSTITLYQIGVWFCVGFFTGAGWAIAAWLVGRILRF |
| Ga0190270_112619291 | 3300018469 | Soil | MPAIVSLYLIGVWFCVGFFTGAGWALAAWLVGRILSHA |
| Ga0190274_106537104 | 3300018476 | Soil | MPTTVSLYACGVWILVGVCTGAGWAFGHWLIGRLLTGVRTAG |
| Ga0190274_124124992 | 3300018476 | Soil | MPSSVTLYLIGVWFCVGFFTGAGWAIAAWIVGRVLRF |
| Ga0193751_100009242 | 3300019888 | Soil | MPSTINLHLIGVWFCVGFFTGAGWAVATWLVGRIIFFI |
| Ga0193751_100023339 | 3300019888 | Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAVIVGRIFAHV |
| Ga0193751_10456573 | 3300019888 | Soil | MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRISSAI |
| Ga0193745_10245972 | 3300020059 | Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRVLGRLV |
| Ga0179590_10043363 | 3300020140 | Vadose Zone Soil | MPSTVNPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI |
| Ga0179592_100032572 | 3300020199 | Vadose Zone Soil | MPSTVTPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI |
| Ga0210407_106041563 | 3300020579 | Soil | MPSTVNPYLIGVWFCVGFFTGAGWAVAGWLVGRILSYL |
| Ga0210407_106464222 | 3300020579 | Soil | MPSTINLYQIGVWFCVGFFTGAGWAVAAVLVGRILSAV |
| Ga0210399_1000134922 | 3300020581 | Soil | MPSTVNLYLIGVWFCVGFFTGAGWVIAAWLVGRILSIIHI |
| Ga0210399_103005272 | 3300020581 | Soil | MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRVFSAI |
| Ga0210399_108179762 | 3300020581 | Soil | MPSTVNPYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI |
| Ga0210395_100068105 | 3300020582 | Soil | MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAI |
| Ga0210395_104177762 | 3300020582 | Soil | MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSTI |
| Ga0210378_102555522 | 3300021073 | Groundwater Sediment | ESNMPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI |
| Ga0179596_102489682 | 3300021086 | Vadose Zone Soil | NMPSTVTPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI |
| Ga0210404_102085053 | 3300021088 | Soil | MPSTINLHQIGVWFCVGFFTGAGWAFAAWLIGRIFSHI |
| Ga0210377_100218246 | 3300021090 | Groundwater Sediment | MPSKIDVYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI |
| Ga0210406_106243993 | 3300021168 | Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVLLTVDTSPGRR |
| Ga0210400_115797951 | 3300021170 | Soil | VPSTVNLYQIGVWFCVGFFTGAGWAIAAWLDGRVLSA |
| Ga0210405_106440651 | 3300021171 | Soil | MPSTVNVKLIGVWFCVGFFTGAGWAVAAWLVGRVLSII |
| Ga0210405_107478572 | 3300021171 | Soil | MPSTVNPYLIGVWFCVGFFTGAGWAVAAWLVGRILSII |
| Ga0210408_10000115122 | 3300021178 | Soil | MPSTINLHQIGVWFCVGFFTGAGWAIAAVLVGRILSAV |
| Ga0210408_102852393 | 3300021178 | Soil | MPSTVNLYQIGVWFCVGFFTGAGWAIASVIVGRIFAHI |
| Ga0210396_110588812 | 3300021180 | Soil | MPATVNLHLIGVWFCVGFFTGAGWAVAAWLVGRVLPV |
| Ga0210396_112400252 | 3300021180 | Soil | MPSTVNVYLIGVWFCVGFFTGAGWAVAGWVVGRVLSIL |
| Ga0193719_100241363 | 3300021344 | Soil | MPSTINLRLIGIWFCVGFFTGAGWSIAALLVGRLLGRL |
| Ga0210393_104377781 | 3300021401 | Soil | LSLQGESNMPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIVSAI |
| Ga0210393_110489462 | 3300021401 | Soil | MPSTVNLHVIGVWFCVGFFTGAGWAVAAWLVGRVLSVIHI |
| Ga0210385_111642021 | 3300021402 | Soil | MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRVFSVI |
| Ga0210389_101243852 | 3300021404 | Soil | MPNTITLYQIGVWFCVGFFTGCGWALALWLVSRLLSRF |
| Ga0210387_117134102 | 3300021405 | Soil | MPSTVNVYLIGVWFCVGFFTGTGWAVAAWLVGRILSIIHI |
| Ga0210386_102338242 | 3300021406 | Soil | MPSTVNLHLIGVWFCVGFFTGAGWATAAWLVGRIISFI |
| Ga0210386_104582612 | 3300021406 | Soil | MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRVLGIIHI |
| Ga0210383_108767043 | 3300021407 | Soil | STVNVYLIGVWFCVGFFTGAGWAAAGWLVGRVLSIL |
| Ga0210383_111766741 | 3300021407 | Soil | GSNMPSTINLYQIGVWFCVGFFTGAGWAVAAVLVGRILSAV |
| Ga0210394_102891311 | 3300021420 | Soil | KFNTPSTVNPHLIGVWFSVGFFTGAGWAVAAWLVGRILSYIHV |
| Ga0210390_111790361 | 3300021474 | Soil | MPSTVNLQLIGVWFCVGFFTGAGWAVAAWLVGRVLSVIHI |
| Ga0210390_116179681 | 3300021474 | Soil | AITTGRESNMPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAI |
| Ga0210398_112955111 | 3300021477 | Soil | INLYQIGVWFCVGFFTGAGWAVAAWLVGRVLSVIHI |
| Ga0210402_120254651 | 3300021478 | Soil | MPTTVSLYLIGVWFCVGFFTGAGWAIANWLIGRVLSRI |
| Ga0210410_100931452 | 3300021479 | Soil | SLQGESKMPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAI |
| Ga0210410_107001381 | 3300021479 | Soil | MPSTVNPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYVHI |
| Ga0210409_114455522 | 3300021559 | Soil | ESNMPSTINLHQIGVWFCVGFFTGAGWAFAAWLIGRIFSHI |
| Ga0212124_107475752 | 3300022553 | Freshwater | MGFLDFMPNAITLYDAAIWFVVGLCTGAGWALGAWLIARVLR |
| Ga0212123_101774152 | 3300022557 | Iron-Sulfur Acid Spring | MPSTINPRLIGVWFCVGFFTGAGWAIAAWLVGRILSAI |
| Ga0212123_103899072 | 3300022557 | Iron-Sulfur Acid Spring | MPSTINLYQIGVWFCVGFFTGAGWAIAGFLVARILTAV |
| Ga0242654_104100512 | 3300022726 | Soil | ASPQGESNMPSTINLHQIGVWFCVGFFTGAGWAFAAWLIGRIFSHI |
| Ga0247785_10356322 | 3300022889 | Soil | MPNDITLYLFGVWFCVGFITGAGWALGSWIIGRLLR |
| Ga0179591_10283967 | 3300024347 | Vadose Zone Soil | MPSTVNLHQIGVWFCVGFFTGAGWASAAWLVGRILRF |
| Ga0208850_10030173 | 3300025457 | Arctic Peat Soil | MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFSII |
| Ga0208850_10062994 | 3300025457 | Arctic Peat Soil | MPSKIDIYQIGVWFCVGFFTSAGWAFAAWLVGRILGFTHI |
| Ga0208850_10083794 | 3300025457 | Arctic Peat Soil | MPSTVNLQLILVWFCVGFFTGAGWAIAAWLVGRILSVI |
| Ga0208850_10218554 | 3300025457 | Arctic Peat Soil | MPGESTMPSTINLQLILVWFCVGFFTGAGWAIAATLVGRILSVI |
| Ga0208850_10262392 | 3300025457 | Arctic Peat Soil | MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRILSAI |
| Ga0208076_10143001 | 3300025464 | Arctic Peat Soil | MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFSVI |
| Ga0208079_10593741 | 3300025481 | Arctic Peat Soil | MPSTINVQLIGVWFCVGFFTGAGWAIAAWLVGRILSAI |
| Ga0207929_10005522 | 3300025505 | Arctic Peat Soil | MPTKLNLELIGVWFCVGFFTGAGWAVATWLVGRIFSAI |
| Ga0208714_10248482 | 3300025527 | Arctic Peat Soil | MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI |
| Ga0208078_10336513 | 3300025544 | Arctic Peat Soil | TVNLYLIGVWFCVGFFTGAGWAIATWLVGRIIFFI |
| Ga0208080_10458461 | 3300025553 | Arctic Peat Soil | LIIPGESTMPSTINLQLILVWFCVGFFTGAGWAIAATLVGRILSVI |
| Ga0208355_10796582 | 3300025581 | Arctic Peat Soil | MPSTLNLQLILVWFCVGFFTGAGWAIAAWLVGRILSVI |
| Ga0208219_10142432 | 3300025625 | Arctic Peat Soil | MPSTINLQLIGVWFCVGFFTGAGWAIAASLVGRIFSVI |
| Ga0209176_100035391 | 3300025854 | Arctic Peat Soil | MPMTITLYLLGVWFCVGFFTGAGWFIASWLVTRLLSKLA |
| Ga0209585_101712881 | 3300025891 | Arctic Peat Soil | MPTKLNLELISVWFCVGFFTGAGWAIATWLVGRILTAI |
| Ga0209585_103396032 | 3300025891 | Arctic Peat Soil | MPGESTMPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRILSLI |
| Ga0208916_103825273 | 3300025896 | Aqueous | MPNTITLYQIGVWCCVGFFTGACWTLGARFIARILR |
| Ga0208916_104401531 | 3300025896 | Aqueous | MPNTITLYQIGVWCCVGFFTGAGWTLGAWLIARILR |
| Ga0207684_113576501 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSKIDVYLIGVWFCVGFFTGAGWAVAAWLVGRILSVI |
| Ga0207654_1000018613 | 3300025911 | Corn Rhizosphere | MPETVTLYGIGVWTCVGFFTGAGWALASWLVSRITR |
| Ga0207693_108536742 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSTVNLYQIGVWCAVGFFTGAGWAFAGWLIGRIFSHI |
| Ga0207650_108378641 | 3300025925 | Switchgrass Rhizosphere | MPSTVNLHQIGVWFCVGFFTGAGWAIAAWLVGRILR |
| Ga0207687_1000090612 | 3300025927 | Miscanthus Rhizosphere | MPSTLTPYALLVWFCVGLFTGLGWACGAWLVGRILK |
| Ga0207686_1000030640 | 3300025934 | Miscanthus Rhizosphere | MPTTITLYQIGVWTAVGFFTGAGWTLGAWLVARILR |
| Ga0207686_100024791 | 3300025934 | Miscanthus Rhizosphere | MPTTITLYQLGVWTAVGFFTGAGWTLGAWLVARILR |
| Ga0207686_109036212 | 3300025934 | Miscanthus Rhizosphere | MPSSINLRLIGVWFCVGFFTGAGWAIAAWLVGRVLRF |
| Ga0207709_1000038762 | 3300025935 | Miscanthus Rhizosphere | MPETVSLYAIGVWCCVGFFTGAGWSLGAWVIGRLLR |
| Ga0207712_100328878 | 3300025961 | Switchgrass Rhizosphere | MPVTVTLYLIGVWFCVGFFTGAGWAIASWLVGRVGSRVG |
| Ga0207712_120479401 | 3300025961 | Switchgrass Rhizosphere | MPSAVNLYQIGVWFCVGFFTGAGWAIAAWLVGRILRF |
| Ga0207702_109714743 | 3300026078 | Corn Rhizosphere | SKIDLYQIGVWFCVGFFTGSGWAVGAWIVGRVFSAI |
| Ga0209855_10397542 | 3300026220 | Permafrost Soil | MPATVSLYLIGVWFCVGFFTGAGWAIAAWLVGRTLSRI |
| Ga0209027_10722382 | 3300026300 | Grasslands Soil | MPSTINLRLIGTWFCVGFFTGAGWSIAALIVSRLLGRL |
| Ga0209419_10256711 | 3300027537 | Forest Soil | MPSTINLYQIGVWFCVGFFTGAGWAIASVIVGRIFAHI |
| Ga0209220_11900171 | 3300027587 | Forest Soil | MEIDMPMTITLYLIGVWFCVGFFAGAGWTLAAHLIGRL |
| Ga0209331_10688242 | 3300027603 | Forest Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHV |
| Ga0209422_10841182 | 3300027629 | Forest Soil | MPSTVNLHLIGVWFCVGFFAGAGWAIAAVLVGRILSAV |
| Ga0209420_10007599 | 3300027648 | Forest Soil | MPSTINLYQIGVWFCVGFFTGAGWAIASVLVGRVLSVI |
| Ga0209011_10440443 | 3300027678 | Forest Soil | MPATVSLYLIGVWFCVGFFTGAGWAIATWLVGRTLSRI |
| Ga0209626_10693661 | 3300027684 | Forest Soil | MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFS |
| Ga0208665_100386764 | 3300027715 | Deep Subsurface | MPTTVTLYQIGVWFCVGFFTGVGWALGSWVVARILR |
| Ga0209261_100131031 | 3300027735 | Wetland Sediment | MPSTITLYQIGVWFCVGFFTGTGWVLGAWVVGRILRF |
| Ga0209448_101275751 | 3300027783 | Bog Forest Soil | MPSKIDAYQIGVWFCVGFFTGAGWATAGWLVGRIFSAI |
| Ga0209514_102363331 | 3300027819 | Groundwater | MPSTINVYQIGVWFCVGFFTGAGWAIAAWLVGRILSRI |
| Ga0209514_102388933 | 3300027819 | Groundwater | MPSKIDVYQIGVWFCVGFFTGAGWAIAAWLVGRILSRI |
| Ga0209514_102728252 | 3300027819 | Groundwater | MPATVNLYLIGVWFCVGFFTGSGWAVAAWLVGRVLSHV |
| Ga0209060_100007606 | 3300027826 | Surface Soil | MPSKIDLHLIGIWFCVGFFTGAGWAIATWLVGRILSVI |
| Ga0209515_105041962 | 3300027835 | Groundwater | MPSTINLYQIGVWFCVGFFTGSGWAIAAWLVGRVLRF |
| Ga0209515_105987642 | 3300027835 | Groundwater | MPSKIDVYQIGVWFCVGFFTGAGWAIAAWLVGRVFSHI |
| Ga0209180_102260461 | 3300027846 | Vadose Zone Soil | MPSTINLYQIGVWFCVGFFTGAGWALAAWLVGRIFSHI |
| Ga0209517_100659065 | 3300027854 | Peatlands Soil | MPSTVNLYLIGVWFCVGFFTGAGWATATWLVGRILSIIHI |
| Ga0209701_104194843 | 3300027862 | Vadose Zone Soil | DRNMPITVSLYLIGVWFCVGFFTGAGWAIAAWLVGRLLSRL |
| Ga0209813_101685782 | 3300027866 | Populus Endosphere | MPSTVNLYLIGVWFCVGFFTGAGWSIAAWLVGRILRF |
| Ga0209167_1000012667 | 3300027867 | Surface Soil | MPSTVNLYLIGVWFCVGFFTGAGWATAAWLVGRILSIIHI |
| Ga0209167_100001423 | 3300027867 | Surface Soil | MPSTVNLHLIGVWFCVGFFTGAGWAAATWLVGRIISFI |
| Ga0209590_100192482 | 3300027882 | Vadose Zone Soil | MPSTINLHQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI |
| Ga0209590_100585813 | 3300027882 | Vadose Zone Soil | MPITVSLYLIGVWFCVGFFTGAGWAIAAWLVGRLLSRF |
| Ga0209380_105343601 | 3300027889 | Soil | MPSTVNVYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI |
| Ga0209068_1000122613 | 3300027894 | Watersheds | MPSAVNVYLIGVWFCVGFFTGAGWAVAAWLVGRILNAI |
| Ga0209624_100191015 | 3300027895 | Forest Soil | MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILGIIHI |
| Ga0209048_1000000413 | 3300027902 | Freshwater Lake Sediment | MPTTISLYQFGIWFCVGFSTGAGWTIAAWLVGRIGTKVA |
| Ga0209048_100367415 | 3300027902 | Freshwater Lake Sediment | MPSTITLYLIGIWFCVGFFAGAGWAIAAWLVGRISSYI |
| Ga0209048_100545593 | 3300027902 | Freshwater Lake Sediment | MPSKIDLYLIGVWFCVGFFTGAGWAIAAWLVGRIFSAI |
| Ga0209488_107102622 | 3300027903 | Vadose Zone Soil | MPTTVSLYLIGVWFCVGFFTGAGWAIAAWLVGRTLSRI |
| Ga0209415_101941882 | 3300027905 | Peatlands Soil | MPSTVNLYQIGVWFCVGFFTGAGWAIAALLVGRILSAV |
| Ga0209006_100082855 | 3300027908 | Forest Soil | MPSTINIHLIGVWFCVGFFTGAGWAIAAWLVARILTAL |
| Ga0209006_104814001 | 3300027908 | Forest Soil | MPSTINLQLIGVWFCVGFFTGAGWAVAAWIVGRILTAI |
| Ga0209006_106553392 | 3300027908 | Forest Soil | MPSTVNPYLIGVWFCVGFFTSAGWAVAAWFVGRILSYIHV |
| Ga0209006_111708281 | 3300027908 | Forest Soil | MPSTINLHLIGVWFCVGFFTGAGWAIAAWLVARILTAI |
| Ga0209583_103238442 | 3300027910 | Watersheds | MPSKIDVYQIGVWFCVGFFTGAGWAVAGWLVGRIFSAI |
| Ga0209698_102251802 | 3300027911 | Watersheds | MPSTINPYLIGVWFCVGFFTGAGWAVAAWLVGRVLSAI |
| Ga0209698_110724011 | 3300027911 | Watersheds | FNMPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSLIHI |
| Ga0209526_100142552 | 3300028047 | Forest Soil | MPATVSLYLIGVWFCVGFFTGAGWAIAAWLVGRTLSRL |
| Ga0209526_108900371 | 3300028047 | Forest Soil | MPSTVNVYLIGVWFCVGFFTGAGWAVAAWLVGRVLAVI |
| Ga0307301_102997231 | 3300028719 | Soil | LPSTINLYQIGVWFCVGFFTGAGWAVAAWLVGRIFSHV |
| Ga0308309_115369231 | 3300028906 | Soil | MPSTVNPYLLGVWFCVGSFTGAGWAVAAWLVGRILSYIHI |
| Ga0302046_109804041 | 3300030620 | Soil | MPSTIKLYLIGVWFCVGFFTGAGWAIAAWLVGRVLANI |
| Ga0170834_1086721572 | 3300031057 | Forest Soil | MPSTINVQLIGVWFCVGFFTGAGWAIAAWLVARILSAL |
| Ga0307497_102290032 | 3300031226 | Soil | MPSTINIYQIGVWFCVGFFTGAGWAIAGWLVGRIFSHI |
| Ga0170824_1051246202 | 3300031231 | Forest Soil | MPSTINLYQIGVWFCVGFFTGVGWAIAALLVGRIFSAV |
| Ga0302325_120390432 | 3300031234 | Palsa | KMPSTVNLYLVGVWFCVGFFTGAGWAVAAWLMGRILSIIHI |
| Ga0265325_1000002990 | 3300031241 | Rhizosphere | MPIKVNLELIIVWFCVGFFTGAGWAIATWLVGRILGLTHL |
| Ga0307442_10968011 | 3300031274 | Salt Marsh | MPSKIDLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSAI |
| Ga0170820_126389442 | 3300031446 | Forest Soil | MPSKINLYQIGVWFCVRFFTSAGWAVAALLVGRILFAV |
| Ga0170818_1106234261 | 3300031474 | Forest Soil | MPSKIDLYQIGVWFCVGFFTGAGWAIAGWLVGRISSAI |
| Ga0310887_106692812 | 3300031547 | Soil | ITTWRIHMPSTINLYQVGVWFCVGFFTGAGWAIAAWLVGRIFSHI |
| Ga0310686_10224404724 | 3300031708 | Soil | MPSAVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI |
| Ga0310686_10404439332 | 3300031708 | Soil | MPSTVNLHLVGVWFCVGFFTGAGWAVATWLVGRIIFFI |
| Ga0310686_1071862961 | 3300031708 | Soil | MMPSNINLYQIGVWFCVGFFTGAGWALAAWLVGRIFSHI |
| Ga0310686_1073731752 | 3300031708 | Soil | MPSTINLYQVGVWFCVGFFTGAGWAVAAWLVGRVMTAI |
| Ga0310686_1170683992 | 3300031708 | Soil | MPSTVNPYLLGVWFCVGFFTGAGWAVAAWLVGRILSYIHV |
| Ga0310686_1179926252 | 3300031708 | Soil | MPSTINLYQIRVWFCVGFFTGAGWAIAALLVGRTFSAV |
| Ga0307468_1022114611 | 3300031740 | Hardwood Forest Soil | MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRVLGRLV |
| Ga0306918_108775072 | 3300031744 | Soil | MPTKIDLYQIGVWFCVGFFTSAGWAIAGWLVGRIFSAV |
| Ga0307477_1000193816 | 3300031753 | Hardwood Forest Soil | MPSIVSLYLIAVWFCVGFFTGAGWMLGARIIGKLL |
| Ga0307477_101002281 | 3300031753 | Hardwood Forest Soil | MPSTVNLYLIGVWFCVGFFTGAGWAIASVIVGRVFAHV |
| Ga0307475_103468782 | 3300031754 | Hardwood Forest Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFTHI |
| Ga0307478_110701051 | 3300031823 | Hardwood Forest Soil | MPSKIDAYQVGVWFCVGFFTGAGWAIAGWLVGRILSVI |
| Ga0307478_115371962 | 3300031823 | Hardwood Forest Soil | MPPKIDLYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAV |
| Ga0310900_113181162 | 3300031908 | Soil | MPNDITLSQCGVWFCVGFFTGGGWAFAQWVIGRLR |
| Ga0306923_124683901 | 3300031910 | Soil | MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFTH |
| Ga0214473_100815786 | 3300031949 | Soil | MPSTVKLYLIGVWFCVGFFTGAGWAVAAWLVGRVLSNI |
| Ga0214473_112270271 | 3300031949 | Soil | MPSTINLYLIGVWFCVGFFTGAGWAIATWLVGRIFSHI |
| Ga0214473_118046722 | 3300031949 | Soil | MPAIVNLYLIGVWFCVGFFTGAGWAIAAWLVGRIFSHI |
| Ga0315540_102749352 | 3300032061 | Salt Marsh Sediment | EGYNMPSKIDLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSAI |
| Ga0318540_103836832 | 3300032094 | Soil | STINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFTHI |
| Ga0311301_101698655 | 3300032160 | Peatlands Soil | MPSTINLYQIGVWFCVGFFTGAGWAIATVLVGRLLSAV |
| Ga0311301_102235923 | 3300032160 | Peatlands Soil | MPSAINLYQIGVWFSVGFFTGAGWAVAAWLVGRVLTAI |
| Ga0311301_103663444 | 3300032160 | Peatlands Soil | MPSTINLQLILVWFCVGFFTGAGWAIAATLVGRILSVI |
| Ga0311301_109407222 | 3300032160 | Peatlands Soil | MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRVLAAI |
| Ga0311301_117633032 | 3300032160 | Peatlands Soil | MPSTINLYQIGVWCCVGFFTGAGWAFAAWLVGRIFSHI |
| Ga0311301_117658891 | 3300032160 | Peatlands Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSVV |
| Ga0311301_118164502 | 3300032160 | Peatlands Soil | MPSTINLHQIGVWFCVGFFTGAGWAVAAWLVGRVLTAI |
| Ga0307470_101426252 | 3300032174 | Hardwood Forest Soil | MPSTIILYQIGVWFCVGFFTGAGWAIAAWLVGRILRF |
| Ga0307470_103065721 | 3300032174 | Hardwood Forest Soil | MPSTVNLNLIGVWFCVGFFTGAGWAIAAWLVGRILGRLI |
| Ga0307470_106181542 | 3300032174 | Hardwood Forest Soil | MPTKVNLELIMVWFCVGFFTGAGWAVATWLVGRILG |
| Ga0307471_1011666801 | 3300032180 | Hardwood Forest Soil | PSTVNLNLIGVWFCVGFFTGAGWAIAAWLVGRILGRLI |
| Ga0306920_1012112652 | 3300032261 | Soil | MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFTHI |
| Ga0315742_133611321 | 3300032756 | Forest Soil | STVNLYQIGVWFCVGFFTGAGWAIATVLVGRILSVV |
| Ga0335084_102680702 | 3300033004 | Soil | MPSTVNLNLIGVWFCVGFFTGAGWAIASWLVGRVLGHVI |
| Ga0316624_100157944 | 3300033486 | Soil | MPSKIDLYQIGVWFCVGFFTGAGWAIAAWLVGRISSAI |
| Ga0334790_004379_8568_8684 | 3300033887 | Soil | MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRILSVI |
| Ga0334790_198528_66_182 | 3300033887 | Soil | MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRILSAV |
| Ga0334792_000440_5476_5592 | 3300033888 | Soil | MPTKFSLELIGVWFCVGFFTGAGWAVATWLVGRIFSAI |
| Ga0326723_0190778_552_668 | 3300034090 | Peat Soil | MPSTINLYQIGVWFCVGFFTGAGWGIAGWLVGRIFSHI |
| Ga0370483_0224628_245_361 | 3300034124 | Untreated Peat Soil | MPSIVNLQLSGVWFCVGFFTGAGWAVATWLVGRIIFFI |
| Ga0364929_0202413_225_338 | 3300034149 | Sediment | MPSAVNLYQIGVWFCVGFFTGAGWATAAWLVGRVLRF |
| Ga0370498_063852_251_364 | 3300034155 | Untreated Peat Soil | MPTTVSLYLIGVWFCVGFFTGAGWAIAAWLVGRVLRF |
| Ga0370507_0275738_42_155 | 3300034158 | Untreated Peat Soil | MPTTVSLYLIGVWFCVGFFTGAGWAIAAWLVGRDLRF |
| ⦗Top⦘ |