Metagenome / Metatranscriptome Family F004241

Overview

Basic Information

• Family ID: F004241
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 447
• Average Sequence Length: 38 residues
• Representative Sequence: MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRILSAV
• Number of Associated Samples: 306
• Number of Associated Scaffolds: 447

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 86.29 %
• % of genes near scaffold ends (potentially truncated): 16.11 %
• % of genes from short scaffolds (< 2000 bps): 73.15 %
• Associated GOLD sequencing projects: 276
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (62.192 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.172 % of family members)
• Environment Ontology (ENVO): Unclassified (17.450 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (50.336 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 46.97%
  β-sheet: 0.00%
  Coil/Unstructured: 53.03%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 447 Family Scaffolds
PF11295	DUF3096	4.03
PF03401	TctC	3.36
PF11752	DUF3309	3.13
PF12680	SnoaL_2	1.57
PF05532	CsbD	1.34
PF13531	SBP_bac_11	1.12
PF07568	HisKA_2	1.12
PF02839	CBM_5_12	1.12
PF00011	HSP20	0.89
PF06823	DUF1236	0.89
PF04226	Transgly_assoc	0.89
PF13545	HTH_Crp_2	0.67
PF02518	HATPase_c	0.67
PF01844	HNH	0.67
PF03330	DPBB_1	0.67
PF08972	DUF1902	0.67
PF04860	Phage_portal	0.45
PF01494	FAD_binding_3	0.45
PF00005	ABC_tran	0.45
PF01850	PIN	0.45
PF01594	AI-2E_transport	0.45
PF02617	ClpS	0.45
PF00313	CSD	0.45
PF04828	GFA	0.45
PF10439	Bacteriocin_IIc	0.45
PF02674	Colicin_V	0.45
PF09361	Phasin_2	0.45
PF00753	Lactamase_B	0.45
PF01391	Collagen	0.45
PF04392	ABC_sub_bind	0.45
PF01042	Ribonuc_L-PSP	0.45
PF13581	HATPase_c_2	0.45
PF01695	IstB_IS21	0.45
PF13560	HTH_31	0.45
PF10387	DUF2442	0.45
PF07813	LTXXQ	0.45
PF01925	TauE	0.22
PF08708	PriCT_1	0.22
PF00873	ACR_tran	0.22
PF00149	Metallophos	0.22
PF13410	GST_C_2	0.22
PF01979	Amidohydro_1	0.22
PF04267	SoxD	0.22
PF10646	Germane	0.22
PF02771	Acyl-CoA_dh_N	0.22
PF00118	Cpn60_TCP1	0.22
PF02705	K_trans	0.22
PF00211	Guanylate_cyc	0.22
PF00128	Alpha-amylase	0.22
PF04008	Adenosine_kin	0.22
PF04616	Glyco_hydro_43	0.22
PF08471	Ribonuc_red_2_N	0.22
PF04234	CopC	0.22
PF02911	Formyl_trans_C	0.22
PF04909	Amidohydro_2	0.22
PF02321	OEP	0.22
PF11638	DnaA_N	0.22
PF00216	Bac_DNA_binding	0.22
PF01370	Epimerase	0.22
PF03450	CO_deh_flav_C	0.22
PF11999	Ice_binding	0.22
PF04002	RadC	0.22
PF00343	Phosphorylase	0.22
PF06325	PrmA	0.22
PF01145	Band_7	0.22
PF12071	DUF3551	0.22
PF11064	DUF2865	0.22
PF13392	HNH_3	0.22
PF06245	DUF1015	0.22
PF05239	PRC	0.22
PF07369	DUF1488	0.22
PF00400	WD40	0.22
PF01402	RHH_1	0.22
PF00027	cNMP_binding	0.22
PF00535	Glycos_transf_2	0.22
PF02586	SRAP	0.22
PF08388	GIIM	0.22
PF00185	OTCace	0.22
PF03814	KdpA	0.22
PF01048	PNP_UDP_1	0.22
PF04964	Flp_Fap	0.22
PF12704	MacB_PCD	0.22
PF00487	FA_desaturase	0.22
PF13505	OMP_b-brl	0.22
PF02353	CMAS	0.22
PF08734	GYD	0.22
PF13827	DUF4189	0.22
PF12778	PXPV	0.22
PF01841	Transglut_core	0.22
PF00459	Inositol_P	0.22
PF12200	DUF3597	0.22
PF04365	BrnT_toxin	0.22
PF13458	Peripla_BP_6	0.22
PF13432	TPR_16	0.22
PF08239	SH3_3	0.22
PF14403	CP_ATPgrasp_2	0.22
PF06277	EutA	0.22
PF00365	PFK	0.22
PF01546	Peptidase_M20	0.22
PF13646	HEAT_2	0.22
PF13712	Glyco_tranf_2_5	0.22
PF01193	RNA_pol_L	0.22
PF08837	DUF1810	0.22
PF00486	Trans_reg_C	0.22
PF00982	Glyco_transf_20	0.22
PF00230	MIP	0.22
PF01842	ACT	0.22
PF02954	HTH_8	0.22
PF00872	Transposase_mut	0.22
PF00355	Rieske	0.22
PF00180	Iso_dh	0.22
PF13400	Tad	0.22
PF11003	DUF2842	0.22
PF11604	CusF_Ec	0.22
PF08240	ADH_N	0.22
PF01988	VIT1	0.22
PF13340	DUF4096	0.22
PF14525	AraC_binding_2	0.22
PF01464	SLT	0.22
PF07732	Cu-oxidase_3	0.22
PF13185	GAF_2	0.22
PF03641	Lysine_decarbox	0.22
PF00106	adh_short	0.22
PF00795	CN_hydrolase	0.22
PF00534	Glycos_transf_1	0.22
PF00034	Cytochrom_C	0.22
PF10722	YbjN	0.22
PF05598	DUF772	0.22
PF07836	DmpG_comm	0.22
PF14237	GYF_2	0.22
PF15919	HicB_lk_antitox	0.22
PF08379	Bact_transglu_N	0.22
PF00665	rve	0.22
PF04191	PEMT	0.22
PF14384	BrnA_antitoxin	0.22
PF07908	Obsolete Pfam Family	0.22
PF00589	Phage_integrase	0.22
PF03354	TerL_ATPase	0.22
PF00248	Aldo_ket_red	0.22
PF03328	HpcH_HpaI	0.22
PF08448	PAS_4	0.22
PF02656	DUF202	0.22
PF13463	HTH_27	0.22
PF06233	Usg	0.22
PF13229	Beta_helix	0.22
PF13751	DDE_Tnp_1_6	0.22
PF10282	Lactonase	0.22
PF05957	DUF883	0.22
PF00512	HisKA	0.22
PF00069	Pkinase	0.22
PF02738	MoCoBD_1	0.22
PF04613	LpxD	0.22
PF13817	DDE_Tnp_IS66_C	0.22
PF00702	Hydrolase	0.22

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 447 Family Scaffolds
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	3.36
COG3678	Periplasmic chaperone Spy, Spy/CpxP family	Posttranslational modification, protein turnover, chaperones [O]	1.79
COG3237	Uncharacterized conserved protein YjbJ, UPF0337 family	Function unknown [S]	1.34
COG3920	Two-component sensor histidine kinase, HisKA and HATPase domains	Signal transduction mechanisms [T]	1.12
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.89
COG2261	Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family	General function prediction only [R]	0.89
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	0.89
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	0.89
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.45
COG1538	Outer membrane protein TolC	Cell wall/membrane/envelope biogenesis [M]	0.45
COG1484	DNA replication protein DnaC	Replication, recombination and repair [L]	0.45
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.45
COG1286	Colicin V production accessory protein CvpA, regulator of purF expression and biofilm formation	Cell wall/membrane/envelope biogenesis [M]	0.45
COG3791	Uncharacterized conserved protein	Function unknown [S]	0.45
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.45
COG0628	Predicted PurR-regulated permease PerM	General function prediction only [R]	0.45
COG2127	ATP-dependent Clp protease adapter protein ClpS	Posttranslational modification, protein turnover, chaperones [O]	0.45
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.45
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.45
COG2372	Copper-binding protein CopC (methionine-rich)	Inorganic ion transport and metabolism [P]	0.22
COG3280	Maltooligosyltrehalose synthase	Carbohydrate transport and metabolism [G]	0.22
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.22
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	0.22
COG2820	Uridine phosphorylase	Nucleotide transport and metabolism [F]	0.22
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.22
COG2890	Methylase of polypeptide chain release factors	Translation, ribosomal structure and biogenesis [J]	0.22
COG2264	Ribosomal protein L11 methylase PrmA	Translation, ribosomal structure and biogenesis [J]	0.22
COG2929	Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system	Defense mechanisms [V]	0.22
COG5579	Uncharacterized conserved protein, DUF1810 family	Function unknown [S]	0.22
COG3158	K+ uptake protein Kup	Inorganic ion transport and metabolism [P]	0.22
COG2230	Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases	Lipid transport and metabolism [I]	0.22
COG0058	Glucan phosphorylase	Carbohydrate transport and metabolism [G]	0.22
COG4819	Ethanolamine utilization protein EutA, possible chaperonin	Amino acid transport and metabolism [E]	0.22
COG3239	Fatty acid desaturase	Lipid transport and metabolism [I]	0.22
COG4311	Sarcosine oxidase delta subunit	Amino acid transport and metabolism [E]	0.22
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.22
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.22
COG4626	Phage terminase-like protein, large subunit, contains N-terminal HTH domain	Mobilome: prophages, transposons [X]	0.22
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	0.22
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.22
COG3847	Flp pilus assembly protein, pilin Flp	Extracellular structures [W]	0.22
COG4575	Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family	Translation, ribosomal structure and biogenesis [J]	0.22
COG3897	Protein N-terminal and lysine N-methylase, NNT1/EFM7 family	Posttranslational modification, protein turnover, chaperones [O]	0.22
COG4198	Uncharacterized conserved protein, DUF1015 family	Function unknown [S]	0.22
COG4274	Uncharacterized conserved protein, contains GYD domain	Function unknown [S]	0.22
COG0380	Trehalose-6-phosphate synthase, GT20 family	Carbohydrate transport and metabolism [G]	0.22
COG1044	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Cell wall/membrane/envelope biogenesis [M]	0.22
COG0813	Purine-nucleoside phosphorylase	Nucleotide transport and metabolism [F]	0.22
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	0.22
COG0775	Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB	Nucleotide transport and metabolism [F]	0.22
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	0.22
COG0580	Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)	Carbohydrate transport and metabolism [G]	0.22
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.22
COG0459	Chaperonin GroEL (HSP60 family)	Posttranslational modification, protein turnover, chaperones [O]	0.22
COG1305	Transglutaminase-like enzyme, putative cysteine protease	Posttranslational modification, protein turnover, chaperones [O]	0.22
COG0366	Glycosidase/amylase (phosphorylase)	Carbohydrate transport and metabolism [G]	0.22
COG0296	1,4-alpha-glucan branching enzyme	Carbohydrate transport and metabolism [G]	0.22
COG0223	Methionyl-tRNA formyltransferase	Translation, ribosomal structure and biogenesis [J]	0.22
COG0209	Ribonucleotide reductase alpha subunit	Nucleotide transport and metabolism [F]	0.22
COG0205	6-phosphofructokinase	Carbohydrate transport and metabolism [G]	0.22
COG0202	DNA-directed RNA polymerase, alpha subunit/40 kD subunit	Transcription [K]	0.22
COG0119	Isopropylmalate/homocitrate/citramalate synthases	Amino acid transport and metabolism [E]	0.22
COG2227	2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase	Coenzyme transport and metabolism [H]	0.22
COG1398	Fatty-acid desaturase	Lipid transport and metabolism [I]	0.22
COG1523	Pullulanase/glycogen debranching enzyme	Carbohydrate transport and metabolism [G]	0.22
COG1611	Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family	Nucleotide transport and metabolism [F]	0.22
COG1633	Rubrerythrin, includes spore coat protein YhjR	Inorganic ion transport and metabolism [P]	0.22
COG1761	DNA-directed RNA polymerase, subunit L/RPAC2	Transcription [K]	0.22
COG1814	Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family	Inorganic ion transport and metabolism [P]	0.22
COG1839	Adenosine/AMP kinase	Nucleotide transport and metabolism [F]	0.22
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.22
COG2003	DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif	Replication, recombination and repair [L]	0.22
COG2060	K+-transporting ATPase, KdpA subunit	Inorganic ion transport and metabolism [P]	0.22
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.22
COG2132	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)	Cell cycle control, cell division, chromosome partitioning [D]	0.22
COG2135	ssDNA abasic site-binding protein YedK/HMCES, SRAP family	Replication, recombination and repair [L]	0.22
COG2149	Uncharacterized membrane protein YidH, DUF202 family	Function unknown [S]	0.22
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.22

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.86 %
Unclassified	root	N/A	37.14 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	62.64 %
Unclassified	root	N/A	37.14 %
Viruses	superkingdom	All Organisms → Viruses	0.22 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	62.19 %
Unclassified	root	N/A	37.14 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	46.98 %
Unclassified	root	N/A	37.14 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	2.91 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.45 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.45 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.45 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.89 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	34.68 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	2.24 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	0.45 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.45 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.45 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.22 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.22 %
Vicinamibacteria	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.89 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.67 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	21.92 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	2.01 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.45 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.45 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	0.22 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.22 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.22 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.22 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	0.22 %
Vicinamibacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Spartobacteria	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria	0.67 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	8.95 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	1.34 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.45 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.22 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.22 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.22 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Vicinamibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae	0.22 %
Sphingosinicellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	0.67 %
unclassified Spartobacteria	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria	0.67 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	0.67 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	7.38 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	1.34 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
unclassified Sphingomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae	0.22 %
Sphingosinicella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella	0.22 %
Acidicaldus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus	0.22 %
Luteitalea	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	1.12 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
unclassified Luteitalea	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea	0.22 %
unclassified Acidicaldus	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus	0.22 %
unclassified Sphingosinicella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.89 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.22 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.22 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.22 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Tylenchina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina	0.22 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.22 %
Panagrolaimomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.22 %
Strongyloidoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Strongyloididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae	0.22 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.22 %
Parastrongyloides	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.22 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	0.22 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	0.22 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	0.22 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Blaberoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea	0.22 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Ectobiidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae	0.22 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Blattellinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae	0.22 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Blattella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella	0.22 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.24 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.01 %
Bradyrhizobium sp. th.b2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	0.45 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.45 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.45 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.45 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.45 %
Blattella germanica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	0.22 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.22 %
Bradyrhizobium sp. Ec3.3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	0.22 %
Sphingosinicella sp. YJ22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	0.22 %
Bradyrhizobium sp. URHD0069	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	0.22 %
Acidicaldus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	0.22 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.22 %
Bradyrhizobium sp. dw_411	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	0.22 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.22 %
Bradyrhizobium rifense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	0.22 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.22 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.22 %
Sphingomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	0.22 %
Bradyrhizobium uaiense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	0.22 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.22 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.22 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.22 %
Roseobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	0.22 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.22 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.89 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.67 %
Spartobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	0.67 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2065487018|GPINP_F5MS3JC02GYVQI	All Organisms → cellular organisms → Bacteria	518
2088090004|P1_DRAFT_NODE_47904_len_1184_cov_10_514359	Not Available	1234
2088090004|P1_DRAFT_NODE_58329_len_775_cov_11_389677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	825
2088090008|P3_DRAFT_NODE_507581_len_2335_cov_21_915632	Not Available	2385
2088090015|GPICI_8998385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1650
2124908028|beta3_all_NODE_9535_len_1163_cov_11_779019	All Organisms → cellular organisms → Bacteria → Proteobacteria	1213
2124908043|A2_c1_ConsensusfromContig59579	Not Available	829
2124908045|KansclcFeb2_ConsensusfromContig1203353	Not Available	804
2140918006|ConsensusfromContig26549	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	706
2140918024|NODE_209741_length_1180_cov_11.294915	Not Available	1230
2140918024|NODE_347176_length_709_cov_8.351199	Not Available	759
2170459002|FZY7DQ102GWQ8D	Not Available	518
2170459003|FZN2CUW02F4SAM	All Organisms → cellular organisms → Bacteria → Proteobacteria	507
2170459009|GA8DASG02I69CA	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	509
2189573002|GZIGXIF02INZZG	Not Available	500
3300000033|ICChiseqgaiiDRAFT_c0671029	All Organisms → cellular organisms → Bacteria	1023
3300000567|JGI12270J11330_10022769	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3829
3300000567|JGI12270J11330_10170275	Not Available	785
3300000567|JGI12270J11330_10192222	Not Available	707
3300001213|JGIcombinedJ13530_100815239	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1677
3300001385|JGI20193J14888_1024534	All Organisms → cellular organisms → Bacteria → Proteobacteria	915
3300001471|JGI12712J15308_10021293	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1700
3300001593|JGI12635J15846_10405886	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	821
3300001593|JGI12635J15846_10670168	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	599
3300002245|JGIcombinedJ26739_100073850	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3151
3300002245|JGIcombinedJ26739_100229278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411	1748
3300002245|JGIcombinedJ26739_100466198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1140
3300002245|JGIcombinedJ26739_101156113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	662
3300002245|JGIcombinedJ26739_101325114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium	611
3300002245|JGIcombinedJ26739_101695435	Not Available	531
3300003861|Ga0031654_10000071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	20128
3300004104|Ga0058891_1464748	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	706
3300004635|Ga0062388_100508577	Not Available	1080
3300005093|Ga0062594_100541928	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	999
3300005093|Ga0062594_101171080	Not Available	759
3300005332|Ga0066388_100844883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1502
3300005332|Ga0066388_101815517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1085
3300005332|Ga0066388_102972075	Not Available	866
3300005439|Ga0070711_101668355	All Organisms → cellular organisms → Bacteria	558
3300005529|Ga0070741_10001401	All Organisms → cellular organisms → Bacteria	74093
3300005530|Ga0070679_102147656	Not Available	508
3300005533|Ga0070734_10000962	All Organisms → cellular organisms → Bacteria	47988
3300005537|Ga0070730_10430276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	852
3300005541|Ga0070733_10000355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	38415
3300005541|Ga0070733_10002334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	13625
3300005542|Ga0070732_10089050	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1810
3300005542|Ga0070732_10215380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1149
3300005543|Ga0070672_101843195	Not Available	544
3300005554|Ga0066661_10053433	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2318
3300005559|Ga0066700_10840714	Not Available	615
3300005574|Ga0066694_10149821	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1106
3300005591|Ga0070761_10070409	All Organisms → cellular organisms → Bacteria	1984
3300005591|Ga0070761_10161841	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1314
3300005602|Ga0070762_10421272	Not Available	864
3300005602|Ga0070762_10760380	Not Available	653
3300005617|Ga0068859_100004440	All Organisms → cellular organisms → Bacteria	14315
3300005718|Ga0068866_10120194	Not Available	1479
3300005764|Ga0066903_100112695	All Organisms → cellular organisms → Bacteria → Proteobacteria	3739
3300005764|Ga0066903_102106899	All Organisms → cellular organisms → Bacteria → Proteobacteria	1086
3300005764|Ga0066903_106470078	Not Available	611
3300005764|Ga0066903_108802436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069	512
3300005833|Ga0074472_10124646	All Organisms → cellular organisms → Bacteria → Proteobacteria	1935
3300005921|Ga0070766_10833219	Not Available	629
3300005921|Ga0070766_11285935	Not Available	507
3300005938|Ga0066795_10014269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2197
3300005938|Ga0066795_10089625	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	913
3300005938|Ga0066795_10170000	Not Available	649
3300005938|Ga0066795_10241854	Not Available	535
3300005947|Ga0066794_10223360	Not Available	566
3300005983|Ga0081540_1000065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	116905
3300005994|Ga0066789_10204227	Not Available	833
3300006028|Ga0070717_10349943	Not Available	1321
3300006038|Ga0075365_10325812	Not Available	1082
3300006038|Ga0075365_10468635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	890
3300006041|Ga0075023_100169344	All Organisms → cellular organisms → Bacteria	820
3300006046|Ga0066652_100455657	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1178
3300006047|Ga0075024_100826000	Not Available	521
3300006050|Ga0075028_100036071	Not Available	2301
3300006050|Ga0075028_100797373	All Organisms → cellular organisms → Bacteria	575
3300006052|Ga0075029_100457089	Not Available	837
3300006055|Ga0097691_1008266	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5417
3300006055|Ga0097691_1016009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3430
3300006055|Ga0097691_1017273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3250
3300006055|Ga0097691_1086052	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	957
3300006058|Ga0075432_10354315	Not Available	623
3300006086|Ga0075019_10154150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1345
3300006086|Ga0075019_10866761	Not Available	578
3300006162|Ga0075030_100225391	Not Available	1506
3300006172|Ga0075018_10230650	Not Available	889
3300006172|Ga0075018_10371985	Not Available	721
3300006174|Ga0075014_100028002	Not Available	2245
3300006174|Ga0075014_100898014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	530
3300006176|Ga0070765_100326932	All Organisms → cellular organisms → Bacteria	1422
3300006176|Ga0070765_100631300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1011
3300006176|Ga0070765_100669802	All Organisms → cellular organisms → Bacteria → Proteobacteria	980
3300006176|Ga0070765_101370820	Not Available	666
3300006354|Ga0075021_10012710	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3	4608
3300006638|Ga0075522_10008093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7182
3300006795|Ga0075520_1037362	All Organisms → cellular organisms → Bacteria	2380
3300006800|Ga0066660_10372543	All Organisms → cellular organisms → Bacteria → Proteobacteria	1168
3300006805|Ga0075464_10046358	All Organisms → cellular organisms → Bacteria → Proteobacteria	2385
3300006805|Ga0075464_10095897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1699
3300006805|Ga0075464_10714730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	620
3300006805|Ga0075464_10990712	All Organisms → cellular organisms → Bacteria	527
3300006805|Ga0075464_11050092	Not Available	512
3300006844|Ga0075428_101183606	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	806
3300006854|Ga0075425_100033826	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5686
3300006854|Ga0075425_100356417	All Organisms → cellular organisms → Bacteria	1684
3300006854|Ga0075425_102491594	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	573
3300006864|Ga0066797_1110721	Not Available	961
3300006871|Ga0075434_101375364	All Organisms → cellular organisms → Bacteria	716
3300006871|Ga0075434_101751275	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	629
3300006871|Ga0075434_102537974	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	513
3300006893|Ga0073928_10192510	All Organisms → cellular organisms → Bacteria → Proteobacteria	1604
3300006893|Ga0073928_10730191	Not Available	689
3300006893|Ga0073928_10986648	Not Available	574
3300006904|Ga0075424_102053822	Not Available	603
3300006930|Ga0079303_10054701	All Organisms → cellular organisms → Bacteria	1421
3300006950|Ga0075524_10540172	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	520
3300007258|Ga0099793_10350203	Not Available	722
3300007258|Ga0099793_10718238	Not Available	504
3300007265|Ga0099794_10490245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	646
3300007788|Ga0099795_10014538	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2443
3300007982|Ga0102924_1000342	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	58256
3300009029|Ga0066793_10075253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1937
3300009038|Ga0099829_10141186	Not Available	1915
3300009038|Ga0099829_10239339	All Organisms → cellular organisms → Bacteria	1478
3300009053|Ga0105095_10504241	Not Available	671
3300009088|Ga0099830_10054776	All Organisms → cellular organisms → Bacteria → Proteobacteria	2827
3300009089|Ga0099828_10013089	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6258
3300009090|Ga0099827_10000220	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	23193
3300009090|Ga0099827_10453216	All Organisms → cellular organisms → Bacteria	1100
3300009098|Ga0105245_10000531	All Organisms → cellular organisms → Bacteria	34976
3300009137|Ga0066709_101136819	Not Available	1149
3300009148|Ga0105243_10000430	Not Available	43898
3300009156|Ga0111538_10050715	All Organisms → cellular organisms → Bacteria	5319
3300009156|Ga0111538_10259761	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	2198
3300009162|Ga0075423_11867876	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	648
3300009162|Ga0075423_12366633	Not Available	578
3300009174|Ga0105241_10000272	All Organisms → cellular organisms → Bacteria	38465
3300009176|Ga0105242_10120447	Not Available	2251
3300009176|Ga0105242_10121522	Not Available	2242
3300009176|Ga0105242_10901680	All Organisms → cellular organisms → Bacteria → Proteobacteria	884
3300009520|Ga0116214_1365188	Not Available	560
3300009522|Ga0116218_1538578	Not Available	520
3300009523|Ga0116221_1067351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1625
3300009525|Ga0116220_10025670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2394
3300009553|Ga0105249_11964686	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	658
3300009643|Ga0116110_1171690	Not Available	711
3300009650|Ga0105857_1023972	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1620
3300009650|Ga0105857_1082921	Not Available	854
3300009662|Ga0105856_1104816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	828
3300009698|Ga0116216_10955223	Not Available	512
3300009700|Ga0116217_10042054	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3383
3300009764|Ga0116134_1075288	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1248
3300009812|Ga0105067_1071435	Not Available	586
3300009819|Ga0105087_1014332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1089
3300009839|Ga0116223_10545729	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	672
3300009839|Ga0116223_10753174	Not Available	558
3300010046|Ga0126384_12338717	Not Available	516
3300010343|Ga0074044_10748387	Not Available	638
3300010360|Ga0126372_11606853	Not Available	689
3300010376|Ga0126381_100542007	Not Available	1647
3300010376|Ga0126381_101371437	All Organisms → cellular organisms → Bacteria	1022
3300010379|Ga0136449_100043750	All Organisms → cellular organisms → Bacteria → Proteobacteria	10298
3300010379|Ga0136449_100335595	All Organisms → cellular organisms → Bacteria → Proteobacteria	2728
3300010379|Ga0136449_100410208	All Organisms → cellular organisms → Bacteria	2398
3300010379|Ga0136449_100682824	All Organisms → cellular organisms → Bacteria → Proteobacteria	1727
3300010379|Ga0136449_100703127	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1694
3300010379|Ga0136449_100879828	Not Available	1464
3300010379|Ga0136449_101692970	All Organisms → cellular organisms → Bacteria	954
3300010379|Ga0136449_101983496	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	860
3300010379|Ga0136449_103266641	Not Available	625
3300010379|Ga0136449_104366250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	522
3300010400|Ga0134122_11997464	Not Available	618
3300010401|Ga0134121_11344742	Not Available	722
3300010403|Ga0134123_10001120	All Organisms → cellular organisms → Bacteria	17587
3300010403|Ga0134123_12389903	All Organisms → cellular organisms → Bacteria → Proteobacteria	593
3300010880|Ga0126350_10027581	Not Available	831
3300011120|Ga0150983_12948007	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	1874
3300011120|Ga0150983_13270530	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2	654
3300011120|Ga0150983_13558260	Not Available	3038
3300011120|Ga0150983_15444480	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	585
3300011269|Ga0137392_11413626	All Organisms → cellular organisms → Bacteria	555
3300011271|Ga0137393_10734045	Not Available	845
3300011410|Ga0137440_1137188	Not Available	504
3300011421|Ga0137462_1006686	Not Available	2035
3300011433|Ga0137443_1010005	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	2262
3300011444|Ga0137463_1082312	Not Available	1208
3300012077|Ga0153929_1051737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	715
3300012150|Ga0153945_1061573	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	657
3300012189|Ga0137388_10073788	All Organisms → cellular organisms → Bacteria → Proteobacteria	2852
3300012189|Ga0137388_10669434	All Organisms → cellular organisms → Bacteria	964
3300012202|Ga0137363_11388984	Not Available	592
3300012205|Ga0137362_10873179	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	769
3300012209|Ga0137379_10039197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4571
3300012211|Ga0137377_10171049	Not Available	2085
3300012227|Ga0137449_1154351	Not Available	504
3300012232|Ga0137435_1103325	All Organisms → cellular organisms → Bacteria → Proteobacteria	858
3300012355|Ga0137369_10287126	All Organisms → cellular organisms → Bacteria	1227
3300012357|Ga0137384_11359897	Not Available	558
3300012361|Ga0137360_11224427	Not Available	649
3300012363|Ga0137390_10543146	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1133
3300012363|Ga0137390_10548962	Not Available	1126
3300012683|Ga0137398_10404782	Not Available	929
3300012685|Ga0137397_10070775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2524
3300012685|Ga0137397_11096640	Not Available	580
3300012917|Ga0137395_10466614	Not Available	908
3300012923|Ga0137359_11300592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	615
3300012923|Ga0137359_11759990	Not Available	507
3300012930|Ga0137407_11417891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	660
3300012931|Ga0153915_11903647	Not Available	696
3300012944|Ga0137410_11765800	Not Available	545
3300012944|Ga0137410_11907728	Not Available	526
3300012948|Ga0126375_10555581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	867
3300012971|Ga0126369_12708692	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	580
3300013503|Ga0120127_10003468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2493
3300014058|Ga0120149_1160173	Not Available	622
3300014158|Ga0181521_10410449	Not Available	665
3300014159|Ga0181530_10018761	All Organisms → cellular organisms → Bacteria	5398
3300014164|Ga0181532_10063517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2393
3300014164|Ga0181532_10250368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1018
3300014165|Ga0181523_10479049	Not Available	688
3300014200|Ga0181526_10220244	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1212
3300014200|Ga0181526_10542837	Not Available	735
3300014489|Ga0182018_10023306	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4045
3300014489|Ga0182018_10249204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	978
3300014489|Ga0182018_10299457	Not Available	875
3300014492|Ga0182013_10065456	All Organisms → cellular organisms → Bacteria → Proteobacteria	2640
3300014495|Ga0182015_10210605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1296
3300014501|Ga0182024_10002981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	41063
3300014501|Ga0182024_10040272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7708
3300014501|Ga0182024_10174967	All Organisms → cellular organisms → Bacteria	2973
3300014501|Ga0182024_10258426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2330
3300014501|Ga0182024_11627057	All Organisms → cellular organisms → Bacteria → Proteobacteria	731
3300014657|Ga0181522_10669984	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	632
3300014838|Ga0182030_10996773	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	738
3300014879|Ga0180062_1005730	All Organisms → Viruses → Predicted Viral	2447
3300015080|Ga0167639_1000134	All Organisms → cellular organisms → Bacteria → Proteobacteria	10580
3300015160|Ga0167642_1006651	Not Available	2097
3300015371|Ga0132258_10467378	All Organisms → cellular organisms → Bacteria → Proteobacteria	3148
3300016371|Ga0182034_11317711	All Organisms → cellular organisms → Bacteria	630
3300016371|Ga0182034_11917008	Not Available	523
3300016730|Ga0181515_1054760	Not Available	846
3300017822|Ga0187802_10001458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6387
3300017823|Ga0187818_10383203	Not Available	623
3300017925|Ga0187856_1016445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3946
3300017925|Ga0187856_1078320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1360
3300017927|Ga0187824_10103036	All Organisms → cellular organisms → Bacteria → Proteobacteria	920
3300017940|Ga0187853_10064875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1847
3300017946|Ga0187879_10501737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	673
3300017955|Ga0187817_10067904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2215
3300017972|Ga0187781_10137608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1709
3300017996|Ga0187891_1037468	All Organisms → cellular organisms → Bacteria	2123
3300018017|Ga0187872_10036899	All Organisms → cellular organisms → Bacteria	2692
3300018019|Ga0187874_10365196	Not Available	583
3300018026|Ga0187857_10306694	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	724
3300018027|Ga0184605_10027529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2326
3300018030|Ga0187869_10513711	Not Available	569
3300018056|Ga0184623_10104780	All Organisms → cellular organisms → Bacteria → Proteobacteria	1307
3300018057|Ga0187858_10489864	Not Available	753
3300018429|Ga0190272_11685013	All Organisms → cellular organisms → Bacteria → Proteobacteria	655
3300018468|Ga0066662_10113896	Not Available	1954
3300018469|Ga0190270_10091949	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. YJ22	2292
3300018469|Ga0190270_10678565	Not Available	1018
3300018469|Ga0190270_11261929	All Organisms → cellular organisms → Bacteria → Proteobacteria	780
3300018476|Ga0190274_10653710	Not Available	1088
3300018476|Ga0190274_12412499	All Organisms → cellular organisms → Bacteria → Proteobacteria	623
3300019888|Ga0193751_1000092	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	79217
3300019888|Ga0193751_1000233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	49184
3300019888|Ga0193751_1045657	Not Available	1922
3300020059|Ga0193745_1024597	Not Available	1320
3300020140|Ga0179590_1004336	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2682
3300020199|Ga0179592_10003257	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6845
3300020579|Ga0210407_10604156	Not Available	855
3300020579|Ga0210407_10646422	All Organisms → cellular organisms → Bacteria	822
3300020581|Ga0210399_10001349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	19131
3300020581|Ga0210399_10300527	Not Available	1340
3300020581|Ga0210399_10817976	Not Available	760
3300020582|Ga0210395_10006810	All Organisms → cellular organisms → Bacteria	8665
3300020582|Ga0210395_10417776	All Organisms → cellular organisms → Bacteria → Proteobacteria	1009
3300021073|Ga0210378_10255552	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	663
3300021086|Ga0179596_10248968	Not Available	877
3300021088|Ga0210404_10208505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1050
3300021090|Ga0210377_10021824	All Organisms → cellular organisms → Bacteria → Proteobacteria	4676
3300021168|Ga0210406_10624399	All Organisms → cellular organisms → Bacteria → Proteobacteria	839
3300021170|Ga0210400_11579795	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	518
3300021171|Ga0210405_10644065	Not Available	823
3300021171|Ga0210405_10747857	All Organisms → cellular organisms → Bacteria	752
3300021178|Ga0210408_10000115	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	127037
3300021178|Ga0210408_10285239	All Organisms → cellular organisms → Bacteria → Proteobacteria	1316
3300021180|Ga0210396_11058881	Not Available	685
3300021180|Ga0210396_11240025	All Organisms → cellular organisms → Bacteria	623
3300021344|Ga0193719_10024136	All Organisms → cellular organisms → Bacteria → Proteobacteria	2602
3300021401|Ga0210393_10437778	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1067
3300021401|Ga0210393_11048946	Not Available	659
3300021402|Ga0210385_11164202	Not Available	592
3300021404|Ga0210389_10124385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1993
3300021405|Ga0210387_11713410	Not Available	532
3300021406|Ga0210386_10233824	All Organisms → cellular organisms → Bacteria	1564
3300021406|Ga0210386_10458261	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1101
3300021407|Ga0210383_10876704	Not Available	766
3300021407|Ga0210383_11176674	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	645
3300021420|Ga0210394_10289131	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense	1437
3300021474|Ga0210390_11179036	Not Available	619
3300021474|Ga0210390_11617968	Not Available	509
3300021477|Ga0210398_11295511	Not Available	573
3300021478|Ga0210402_12025465	Not Available	502
3300021479|Ga0210410_10093145	All Organisms → cellular organisms → Bacteria → Proteobacteria	2656
3300021479|Ga0210410_10700138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	895
3300021559|Ga0210409_11445552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	563
3300022553|Ga0212124_10747575	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	504
3300022557|Ga0212123_10177415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1608
3300022557|Ga0212123_10389907	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	937
3300022726|Ga0242654_10410051	Not Available	522
3300022889|Ga0247785_1035632	Not Available	596
3300024347|Ga0179591_1028396	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4080
3300025457|Ga0208850_1003017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3892
3300025457|Ga0208850_1006299	All Organisms → cellular organisms → Bacteria	2439
3300025457|Ga0208850_1008379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2032
3300025457|Ga0208850_1021855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1136
3300025457|Ga0208850_1026239	All Organisms → cellular organisms → Bacteria → Proteobacteria	1018
3300025464|Ga0208076_1014300	All Organisms → cellular organisms → Bacteria	1352
3300025481|Ga0208079_1059374	All Organisms → cellular organisms → Bacteria → Proteobacteria	831
3300025505|Ga0207929_1000552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10213
3300025527|Ga0208714_1024848	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1430
3300025544|Ga0208078_1033651	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1121
3300025553|Ga0208080_1045846	All Organisms → cellular organisms → Bacteria → Proteobacteria	1163
3300025581|Ga0208355_1079658	Not Available	727
3300025625|Ga0208219_1014243	Not Available	2474
3300025854|Ga0209176_10003539	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2820
3300025891|Ga0209585_10171288	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	844
3300025891|Ga0209585_10339603	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	606
3300025896|Ga0208916_10382527	Not Available	614
3300025896|Ga0208916_10440153	All Organisms → cellular organisms → Bacteria → Proteobacteria	568
3300025910|Ga0207684_11357650	Not Available	583
3300025911|Ga0207654_10000186	All Organisms → cellular organisms → Bacteria	38488
3300025915|Ga0207693_10853674	Not Available	700
3300025925|Ga0207650_10837864	Not Available	780
3300025927|Ga0207687_10000906	All Organisms → cellular organisms → Bacteria	20175
3300025934|Ga0207686_10000306	All Organisms → cellular organisms → Bacteria	35551
3300025934|Ga0207686_10002479	Not Available	10021
3300025934|Ga0207686_10903621	All Organisms → cellular organisms → Bacteria → Proteobacteria	713
3300025935|Ga0207709_10000387	Not Available	43799
3300025961|Ga0207712_10032887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3502
3300025961|Ga0207712_12047940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	512
3300026078|Ga0207702_10971474	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense	842
3300026220|Ga0209855_1039754	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	818
3300026300|Ga0209027_1072238	All Organisms → cellular organisms → Bacteria → Proteobacteria	1279
3300027537|Ga0209419_1025671	All Organisms → cellular organisms → Bacteria → Acidobacteria	1095
3300027587|Ga0209220_1190017	Not Available	523
3300027603|Ga0209331_1068824	Not Available	884
3300027629|Ga0209422_1084118	Not Available	743
3300027648|Ga0209420_1000759	All Organisms → cellular organisms → Bacteria → Proteobacteria	16152
3300027678|Ga0209011_1044044	All Organisms → cellular organisms → Bacteria	1380
3300027684|Ga0209626_1069366	Not Available	894
3300027715|Ga0208665_10038676	Not Available	1357
3300027735|Ga0209261_10013103	Not Available	2078
3300027783|Ga0209448_10127575	Not Available	851
3300027819|Ga0209514_10236333	Not Available	883
3300027819|Ga0209514_10238893	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	876
3300027819|Ga0209514_10272825	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	791
3300027826|Ga0209060_10000760	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	46875
3300027835|Ga0209515_10504196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae	625
3300027835|Ga0209515_10598764	Not Available	553
3300027846|Ga0209180_10226046	Not Available	1078
3300027854|Ga0209517_10065906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2604
3300027862|Ga0209701_10419484	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	742
3300027866|Ga0209813_10168578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	794
3300027867|Ga0209167_10000126	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	74805
3300027867|Ga0209167_10000142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	69929
3300027882|Ga0209590_10019248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3412
3300027882|Ga0209590_10058581	All Organisms → cellular organisms → Bacteria → Proteobacteria	2176
3300027889|Ga0209380_10534360	Not Available	682
3300027894|Ga0209068_10001226	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	12932
3300027895|Ga0209624_10019101	All Organisms → cellular organisms → Bacteria → Proteobacteria	4349
3300027902|Ga0209048_10000004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	195745
3300027902|Ga0209048_10036741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4099
3300027902|Ga0209048_10054559	All Organisms → cellular organisms → Bacteria → Proteobacteria	3239
3300027903|Ga0209488_10710262	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	720
3300027905|Ga0209415_10194188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	1931
3300027908|Ga0209006_10008285	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9396
3300027908|Ga0209006_10481400	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1037
3300027908|Ga0209006_10655339	Not Available	863
3300027908|Ga0209006_11170828	Not Available	602
3300027910|Ga0209583_10323844	All Organisms → cellular organisms → Bacteria → Proteobacteria	708
3300027911|Ga0209698_10225180	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1507
3300027911|Ga0209698_11072401	Not Available	598
3300028047|Ga0209526_10014255	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5499
3300028047|Ga0209526_10890037	Not Available	542
3300028719|Ga0307301_10299723	Not Available	527
3300028906|Ga0308309_11536923	Not Available	568
3300030620|Ga0302046_10980404	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	673
3300031057|Ga0170834_108672157	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	865
3300031226|Ga0307497_10229003	Not Available	820
3300031231|Ga0170824_105124620	Not Available	549
3300031234|Ga0302325_12039043	Not Available	706
3300031241|Ga0265325_10000029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	103942
3300031274|Ga0307442_1096801	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	862
3300031446|Ga0170820_12638944	Not Available	649
3300031474|Ga0170818_110623426	Not Available	588
3300031547|Ga0310887_10669281	Not Available	642
3300031708|Ga0310686_102244047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	24124
3300031708|Ga0310686_104044393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	29287
3300031708|Ga0310686_107186296	Not Available	505
3300031708|Ga0310686_107373175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidicaldus → unclassified Acidicaldus → Acidicaldus sp.	1156
3300031708|Ga0310686_117068399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1376
3300031708|Ga0310686_117992625	Not Available	986
3300031740|Ga0307468_102211461	Not Available	532
3300031744|Ga0306918_10877507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	699
3300031753|Ga0307477_10001938	Not Available	16446
3300031753|Ga0307477_10100228	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2014
3300031754|Ga0307475_10346878	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1193
3300031823|Ga0307478_11070105	All Organisms → cellular organisms → Bacteria → Proteobacteria	673
3300031823|Ga0307478_11537196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	550
3300031908|Ga0310900_11318116	Not Available	604
3300031910|Ga0306923_12468390	Not Available	513
3300031949|Ga0214473_10081578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3783
3300031949|Ga0214473_11227027	Not Available	774
3300031949|Ga0214473_11804672	All Organisms → cellular organisms → Bacteria	604
3300032061|Ga0315540_10274935	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → unclassified Spartobacteria → Spartobacteria bacterium	704
3300032094|Ga0318540_10383683	All Organisms → cellular organisms → Bacteria	679
3300032160|Ga0311301_10169865	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3857
3300032160|Ga0311301_10223592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3168
3300032160|Ga0311301_10366344	All Organisms → cellular organisms → Bacteria → Proteobacteria	2238
3300032160|Ga0311301_10940722	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1156
3300032160|Ga0311301_11763303	Not Available	740
3300032160|Ga0311301_11765889	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	739
3300032160|Ga0311301_11816450	All Organisms → cellular organisms → Bacteria → Proteobacteria	725
3300032174|Ga0307470_10142625	All Organisms → cellular organisms → Bacteria → Proteobacteria	1452
3300032174|Ga0307470_10306572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1080
3300032174|Ga0307470_10618154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	813
3300032180|Ga0307471_101166680	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	935
3300032261|Ga0306920_101211265	All Organisms → cellular organisms → Bacteria → Proteobacteria	1090
3300032756|Ga0315742_13361132	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	516
3300033004|Ga0335084_10268070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1768
3300033486|Ga0316624_10015794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4071
3300033887|Ga0334790_004379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	9344
3300033887|Ga0334790_198528	Not Available	577
3300033888|Ga0334792_000440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	30591
3300034090|Ga0326723_0190778	Not Available	907
3300034124|Ga0370483_0224628	Not Available	641
3300034149|Ga0364929_0202413	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	657
3300034155|Ga0370498_063852	Not Available	829
3300034158|Ga0370507_0275738	Not Available	558

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	90.83%
Host-Associated	Host-Associated	9.17%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	71.59%
Aquatic	Environmental → Aquatic	19.24%
Plants	Host-Associated → Plants	8.72%
Fungi	Host-Associated → Fungi	0.45%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	69.80%
Freshwater	Environmental → Aquatic → Freshwater	9.62%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.94%
Sediment	Environmental → Aquatic → Sediment	6.04%
Marine	Environmental → Aquatic → Marine	2.24%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.34%
Peat	Environmental → Terrestrial → Peat	1.12%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.12%
Roots	Host-Associated → Plants → Roots	0.67%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.45%
Mycelium	Host-Associated → Fungi → Mycelium	0.45%
Floodplain	Environmental → Terrestrial → Floodplain	0.22%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	51.01%
Loam	Environmental → Terrestrial → Soil → Loam	11.63%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	6.71%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.26%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.04%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.34%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.12%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.12%
Coastal	Environmental → Aquatic → Marine → Coastal	1.57%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.89%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.89%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.67%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.67%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.67%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.45%
Sand	Environmental → Terrestrial → Soil → Sand	0.45%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.45%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.45%
Lake	Environmental → Aquatic → Freshwater → Lake	0.22%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.22%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.22%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.22%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.95%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.30%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	10.51%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	7.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.26%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.04%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	5.15%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	4.92%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.36%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	1.34%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	1.12%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.12%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.12%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.57%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.57%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.89%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.89%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.67%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.67%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.67%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.67%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.45%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.45%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.45%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.45%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.45%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.22%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.22%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.22%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.22%

Habitat

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	7.83%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	6.71%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	6.26%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	5.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.70%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	3.80%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.91%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	2.68%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	2.68%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.24%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.24%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.01%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	1.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	1.79%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	1.34%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.34%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	1.12%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.12%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.12%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	1.12%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	1.57%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.57%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.57%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.57%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.89%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.89%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.89%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.89%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.67%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.67%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.67%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.67%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.67%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.45%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.45%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	0.45%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.45%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.45%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.45%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.45%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	0.45%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.45%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.45%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.45%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.45%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.22%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.22%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.22%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.22%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.22%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	0.22%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.22%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.22%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.22%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.22%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.22%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.22%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.22%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.22%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.22%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.22%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.22%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.22%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.22%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.22%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.22%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.22%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.22%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.22%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.22%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.22%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2065487018	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
2088090004	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1	Environmental
2088090008	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3	Environmental
2088090015	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
2124908028	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3	Environmental
2124908043	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2	Environmental
2124908045	Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011	Environmental
2140918006	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1	Environmental
2140918024	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all	Environmental
2170459002	Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm	Environmental
2170459003	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm	Environmental
2170459009	Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm	Environmental
2189573002	Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)	Environmental
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300000567	Peat soil microbial communities from Weissenstadt, Germany - SII-2010	Environmental
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental
3300001385	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012	Environmental
3300001471	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2	Environmental
3300001593	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2	Environmental
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental
3300003861	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR	Environmental
3300004104	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)	Environmental
3300004635	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3	Environmental
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental
3300005938	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191	Environmental
3300005947	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190	Environmental
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated
3300005994	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049	Environmental
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental
3300006055	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012	Environmental
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated
3300006086	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013	Environmental
3300006162	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012	Environmental
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental
3300006638	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A	Environmental
3300006795	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B	Environmental
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006864	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193	Environmental
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006930	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC	Environmental
3300006950	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one	Environmental
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental
3300007982	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG	Environmental
3300009029	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189	Environmental
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009520	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG	Environmental
3300009522	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG	Environmental
3300009523	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG	Environmental
3300009525	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG	Environmental
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009643	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40	Environmental
3300009650	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061	Environmental
3300009662	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060	Environmental
3300009698	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG	Environmental
3300009700	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG	Environmental
3300009764	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40	Environmental
3300009812	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60	Environmental
3300009819	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50	Environmental
3300009839	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG	Environmental
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010379	Sb_50d combined assembly	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300010880	Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental
3300011410	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2	Environmental
3300011421	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2	Environmental
3300011433	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2	Environmental
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental
3300012077	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ013 MetaG	Host-Associated
3300012150	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ029 MetaG	Host-Associated
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental
3300012227	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2	Environmental
3300012232	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2	Environmental
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300013503	Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M	Environmental
3300014058	Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M	Environmental
3300014158	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG	Environmental
3300014159	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG	Environmental
3300014164	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG	Environmental
3300014165	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG	Environmental
3300014200	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG	Environmental
3300014489	Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG	Environmental
3300014492	Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG	Environmental
3300014495	Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG	Environmental
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental
3300014657	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG	Environmental
3300014838	Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)	Environmental
3300014879	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D	Environmental
3300015080	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary)	Environmental
3300015160	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river))	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental
3300016730	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)	Environmental
3300017822	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2	Environmental
3300017823	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3	Environmental
3300017925	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40	Environmental
3300017927	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4	Environmental
3300017940	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100	Environmental
3300017946	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10	Environmental
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental
3300017996	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40	Environmental
3300018017	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40	Environmental
3300018019	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150	Environmental
3300018026	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100	Environmental
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental
3300018030	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100	Environmental
3300018043	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10	Environmental
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental
3300018057	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150	Environmental
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental
3300020059	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2	Environmental
3300020140	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)	Environmental
3300020199	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)	Environmental
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental
3300021073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo	Environmental
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental
3300021090	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo	Environmental
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental
3300021406	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O	Environmental
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental
3300021474	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O	Environmental
3300021477	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O	Environmental
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental
3300021479	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M	Environmental
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental
3300022553	Powell_combined assembly	Environmental
3300022557	Paint Pots_combined assembly	Environmental
3300022726	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)	Environmental
3300022889	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4	Environmental
3300024347	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)	Environmental
3300025457	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)	Environmental
3300025464	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes)	Environmental
3300025481	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes)	Environmental
3300025505	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)	Environmental
3300025527	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)	Environmental
3300025544	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)	Environmental
3300025553	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes)	Environmental
3300025581	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes)	Environmental
3300025625	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)	Environmental
3300025854	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)	Environmental
3300025891	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)	Environmental
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated
3300026220	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 (SPAdes)	Environmental
3300026300	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)	Environmental
3300027537	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)	Environmental
3300027587	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)	Environmental
3300027603	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)	Environmental
3300027629	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)	Environmental
3300027648	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)	Environmental
3300027678	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)	Environmental
3300027684	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)	Environmental
3300027715	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)	Environmental
3300027735	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes)	Environmental
3300027783	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)	Environmental
3300027819	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)	Environmental
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental
3300027835	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes)	Environmental
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental
3300027854	Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)	Environmental
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental
3300027866	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)	Host-Associated
3300027867	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)	Environmental
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental
3300027889	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)	Environmental
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental
3300027895	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)	Environmental
3300027902	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)	Environmental
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental
3300028719	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182	Environmental
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental
3300030620	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111	Environmental
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental
3300031234	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2	Environmental
3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Host-Associated
3300031274	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30	Environmental
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental
3300032061	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10	Environmental
3300032094	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25	Environmental
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental
3300032756	Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly	Environmental
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental
3300033887	Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1	Environmental
3300033888	Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1	Environmental
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental
3300034124	Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14	Environmental
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental
3300034155	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17	Environmental
3300034158	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPINP_02086760	2065487018	Soil	PSTVNLYQIGVWFCVGFFTGAGWAVAAWLVGRILRF
P1_DRAFT_00325050	2088090004	Soil	MPSTINLQLILVWFCVGFFTGAGWAIAAWLVGRILSVI
P1_DRAFT_00349730	2088090004	Soil	MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFS
P3_DRAFT_00618690	2088090008	Soil	MPSTITLYLIGVWFCVGFFTGAGWAIAAWLVGRIGSKVA
GPICI_03308240	2088090015	Soil	MPSKIDLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI
beta3_all_01133800	2124908028	Soil	MPSTINLQLILVWFCVGFFTGAGWAIAASLVGRILSVI
A2_c1_00708740	2124908043	Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRILRF
KansclcFeb2_04403050	2124908045	Soil	MPSTVTLYLIGVWFCVGFFTGAGWSIAAWLVGRILRF
P1_C_01050930	2140918006	Soil	MPSTINLQLILVWFCVGFFTGAGWAIAAWLVGRIFSVI
B_all_v_00352150	2140918024	Soil	STMPSTINLQLILVWFCVGFFTGAGWAIAATLVGRILSVI
B_all_v_02222730	2140918024	Soil	MPSKIDIYQIGVWFCVGFFTSAGWALAAWLVGRILG
E1_02421900	2170459002	Grass Soil	MPSTINLYLIGVWSAVGFFTGAGWAFAGWLVGRIFSHI
E4A_10645650	2170459003	Grass Soil	MPSTINLYQIGVWFCVGFFTGAGWALGAWLVGRIFSHI
F47_05724320	2170459009	Grass Soil	MPTTVSLYLVGVWFCVGFFTGAGWAIAGWLVGRVLARI
FE1_07231270	2189573002	Grass Soil	MPSKIDLYQIGVWFCVGFFTGAGWAVAGWLVGRIFSAI
ICChiseqgaiiDRAFT_06710292	3300000033	Soil	MPSKIDLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI*
JGI12270J11330_100227692	3300000567	Peatlands Soil	MPSTVNLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV*
JGI12270J11330_101702752	3300000567	Peatlands Soil	MPSTVNLYQIGVWFCVGLFTGAGWAIAAFLVGRILSAV*
JGI12270J11330_101922222	3300000567	Peatlands Soil	MPSNINLYQIGVWFCVGFFTGAGWAIAALLVGRILSAV*
JGIcombinedJ13530_1008152393	3300001213	Wetland	MPTTVTLYQISVWCCVGFFTGAGWAFGAWIVARLLRSA*
JGI20193J14888_10245342	3300001385	Arctic Peat Soil	MPSTINVQLIGVWFCVGFFTGAGWAIAAWLVGRILSAI*
JGI12712J15308_100212932	3300001471	Forest Soil	MPSTINIHLIGVWFCVGFFTGAGWAIAAWLVARILTAL*
JGI12635J15846_104058862	3300001593	Forest Soil	MPATVSLYLIGVWFCVGFFTGAGWAIATWLVGRTLSRI*
JGI12635J15846_106701682	3300001593	Forest Soil	GSTMPSTINLYQIGVWFCVGFFTGAGWAVAAVLVGRILSAV*
JGIcombinedJ26739_1000738503	3300002245	Forest Soil	MPSTVNLYQIGVWFCVGFFTGAGWAIASVIVGRIFAHI*
JGIcombinedJ26739_1002292781	3300002245	Forest Soil	MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILGIIHI*
JGIcombinedJ26739_1004661983	3300002245	Forest Soil	MPSTVNLYLVGVWFCVGFFTGAGWAVAAWLVGRILSII
JGIcombinedJ26739_1011561131	3300002245	Forest Soil	MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSVV*
JGIcombinedJ26739_1013251142	3300002245	Forest Soil	MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSTI*
JGIcombinedJ26739_1016954351	3300002245	Forest Soil	MEIDMPMTITLYLIGVWFCVGFFAGAGWTLAAHLIGRLL*
Ga0031654_1000007112	3300003861	Freshwater Lake Sediment	MPTTISLYQFGIWFCVGFSTGAGWTIAAWLVGRIGTKVA*
Ga0058891_14647481	3300004104	Forest Soil	NMPSTINLHQIGVWFCVGFFTGAGWAFAAWLIGRIFSHI*
Ga0062388_1005085772	3300004635	Bog Forest Soil	MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI*
Ga0062594_1005419282	3300005093	Soil	MPVTVTLYLIGVWFCVGFFTGAGWAIASWLVGRVGSRVG*
Ga0062594_1011710802	3300005093	Soil	MPSNINLYQIGVWFCVGFFTGSGWAIAAWLVGRVLGRLI*
Ga0066388_1008448832	3300005332	Tropical Forest Soil	MPTAINLTLIGVWFCVGFFAGAGWAIAAWLVGRTLGRLA*
Ga0066388_1018155171	3300005332	Tropical Forest Soil	MPSTVNLNLIGVWFCVGFFTGAGWAIAAWLVGRVLGHII*
Ga0066388_1029720752	3300005332	Tropical Forest Soil	MPSIVNLKLIGIWFCVGFFTGAGGAIAAWLVGRTLGRLV*
Ga0070711_1016683551	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MPTKVNLELIMVWFCVGFFTGAGWAVATWLVGRILGLTHL*
Ga0070741_1000140131	3300005529	Surface Soil	VPATITPYLIGVWFCVGFFTGCGWALALWLVGRLLARF*
Ga0070679_1021476561	3300005530	Corn Rhizosphere	MPSTISLPLIGIWFCVGFFTGLGWFVAGRILEGYSNGYVQ
Ga0070734_1000096256	3300005533	Surface Soil	MPSKIDLHLIGIWFCVGFFTGAGWAIATWLVGRILSVI*
Ga0070730_104302761	3300005537	Surface Soil	MPSTVNLYLVGVWFCVGFFTGAGWATATWLVGRILSIIHI*
Ga0070733_1000035511	3300005541	Surface Soil	MPSTVNLYLIGVWFCVGFFTGAGWATAAWLVGRILSIIHI*
Ga0070733_100023348	3300005541	Surface Soil	MPSTVNLHLIGVWFCVGFFTGAGWAAATWLVGRIISFI*
Ga0070732_100890502	3300005542	Surface Soil	MPSTINLHQIGVWFCVGFFTGAGWAFAAWLIGRIFSHI*
Ga0070732_102153802	3300005542	Surface Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAVLVGRILAAV*
Ga0070672_1018431952	3300005543	Miscanthus Rhizosphere	MPSNINLYQIGVWFCVGFFTGSGWAIAAWLVGRVLG
Ga0066661_100534332	3300005554	Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHV*
Ga0066700_108407142	3300005559	Soil	TINLRLIGIWFCVGFFTGAGWAIAALLVSRLLGRF*
Ga0066694_101498212	3300005574	Soil	MPSTINLRLIGIWFCVGFFTGAGWSIAALIVSRLLGRL*
Ga0070761_100704091	3300005591	Soil	MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAI*
Ga0070761_101618415	3300005591	Soil	MPSTINLYQIGVWFCVGFFTGAGWAVAAVLVGRILSAV*
Ga0070762_104212722	3300005602	Soil	MPSTVNPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI*
Ga0070762_107603802	3300005602	Soil	MPSTINIHLIGVWFCVGFFTGAGWAIAAWLVARILTAI*
Ga0068859_1000044403	3300005617	Switchgrass Rhizosphere	MPTAVTIYNLGVWFCVGLFTSLGWSCGAWLVSRVLR*
Ga0068866_101201942	3300005718	Miscanthus Rhizosphere	MPSTVNLHQIGVWFCVGFFTGAGWAIAAWLVGRILRF*
Ga0066903_1001126956	3300005764	Tropical Forest Soil	MPSTINLQQIGVWFCVGFFTGAGWALAAWLVGRIFTHI*
Ga0066903_1021068993	3300005764	Tropical Forest Soil	MPSTVNLNLIGVWFCVGFFTGAGWAIASWLVGRVLGHII*
Ga0066903_1064700781	3300005764	Tropical Forest Soil	MPSKINLYQIGVWFCVGFFTSAGWAIAALLVGRILSAV*
Ga0066903_1088024362	3300005764	Tropical Forest Soil	MLSKNNLYQIGVWFCVGFFTSADWAIAALLVGRILSAV*
Ga0074472_101246464	3300005833	Sediment (Intertidal)	MPSTINLYQIGVWSCVGFFTGAGWAIAAWIVGRILRF*
Ga0070766_108332192	3300005921	Soil	INLYQIGVWFCVGFFTGAGWAVAAVLVGRILSAV*
Ga0070766_112859351	3300005921	Soil	MPSTVNVYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI*
Ga0066795_100142693	3300005938	Soil	MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFSII*
Ga0066795_100896252	3300005938	Soil	MPSTINLQLILVWFCVGFFTGAGWAIAASLVGRILSVI*
Ga0066795_101700003	3300005938	Soil	MPSTVNLQLILVWFCVGFFTGAGWAIAAWLVGRILSVI*
Ga0066795_102418542	3300005938	Soil	MPSKIDIYQIGVWFCVGFFTSAGWALAAWLVGRILGFTHI*
Ga0066794_102233602	3300005947	Soil	MPMTITLYLLGVWFCVGFFTGAGWFIASWLVTRLLSKLA*
Ga0081540_10000655	3300005983	Tabebuia Heterophylla Rhizosphere	MPTNINPRLIGIWFCVGFFTGAGWAIAAWLVGRVFSHI*
Ga0066789_102042272	3300005994	Soil	MPSTINLQLILVWFCVGFFTGAGWAIAATFVGRILSVI*
Ga0070717_103499433	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MPSTVNAYLIGVWFCVGFFTGAGWAVAAWLVGRILSAI*
Ga0075365_103258122	3300006038	Populus Endosphere	MPSTVNLYLIGVWFCVGFFTGAGWSIAAWLVGRILRF*
Ga0075365_104686352	3300006038	Populus Endosphere	MPATVNLYLIGVWFCVGFFTGAGWSIAAWLVGRILRF*
Ga0075023_1001693443	3300006041	Watersheds	MPSAVNVYLIGVWFCVGFFTGAGWAVAAWLVGRILNAI*
Ga0066652_1004556572	3300006046	Soil	MPMAINLKLIGVWFCVGFFTGAGWAIAAWLVGRTLGRFV*
Ga0075024_1008260001	3300006047	Watersheds	MPSTISLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV*
Ga0075028_1000360712	3300006050	Watersheds	MPSTVNLYLIGVWFCVGFFTGSGWAVAAWLVGRILSIIHI*
Ga0075028_1007973731	3300006050	Watersheds	MPSKIDLYQIGVWFCVGFFTGAGWAVAAWLVGRIFSAI*
Ga0075029_1004570892	3300006052	Watersheds	MPSTINLYQIGVWFCVGFFTGAGWAIAALLVGRIFSTV*
Ga0097691_10082665	3300006055	Arctic Peat Soil	MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRILSAI*
Ga0097691_10160092	3300006055	Arctic Peat Soil	MPSTVNLYLIGVWFCVGFFTGAGWAIATWLVGRIIFFI*
Ga0097691_10172738	3300006055	Arctic Peat Soil	MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSFIHI*
Ga0097691_10860523	3300006055	Arctic Peat Soil	MPSTINLQLILVWFCVGFFTGAGWAIAATLVGRILSVI*
Ga0075432_103543151	3300006058	Populus Rhizosphere	TVNLYLIGVWFCVGFFTGAGWSIAAWLVGRILRF*
Ga0075019_101541503	3300006086	Watersheds	MPSTINLYQIGVWFCVGFFTGAGWAIAALIVGRIFSAV*
Ga0075019_108667611	3300006086	Watersheds	NMPSTVNLYLIGVWFCVGFFTGAGWAIATWLVGRIIFFV*
Ga0075030_1002253912	3300006162	Watersheds	MPSTINPYLIGVWFCVGFFTGAGWAVAAWLVGRVLSAI*
Ga0075018_102306501	3300006172	Watersheds	KIDVYQIGVWFCVGFFTGAGWAVAGWLVGRIFSAI*
Ga0075018_103719851	3300006172	Watersheds	NLYLIGVWFCVGFFTGAGRAVAAWLVGRILSIIHI*
Ga0075014_1000280021	3300006174	Watersheds	ESNMPSTINLYQIGVWFCVGFFTGAGWAIAALIVGRIFSAV*
Ga0075014_1008980142	3300006174	Watersheds	MPSKIDVYQIGVWFCVGFFTGAGWAIAAWLVARILTAI*
Ga0070765_1003269323	3300006176	Soil	MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRVFSAI*
Ga0070765_1006313003	3300006176	Soil	MPSTVNPYLLGVWFCVGSFTGAGWAVAAWLVGRILSYIHI*
Ga0070765_1006698022	3300006176	Soil	MPSNINLYQIGVWFCVGFFTGAGWAIASVIVGRIFAHI*
Ga0070765_1013708202	3300006176	Soil	MPSKIDVYLIGVWFCVGFFTGAGWAIAGWLVGRIFAAI*
Ga0075021_100127104	3300006354	Watersheds	MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSLIHI*
Ga0075522_100080932	3300006638	Arctic Peat Soil	MPTKLNLELIDVWFCVGFFTGAGWAVAAWLVGRIFSAI*
Ga0075520_10373623	3300006795	Arctic Peat Soil	MPTKLNLELIGVWFCVGFFTGAGWAVATWLVGRIFSAI*
Ga0066660_103725433	3300006800	Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLAGRIFSHV*
Ga0075464_100463583	3300006805	Aqueous	MPNTITLYQIGVWCCVGFFTGAGWTLGAWLIARILR*
Ga0075464_100958973	3300006805	Aqueous	MPNTITLYQIGVWCCVGFFTGACWTLGARFIARILR*
Ga0075464_107147302	3300006805	Aqueous	MPNTITLYQIGVWCCVGFFTGAGWALGAWLIARILR*
Ga0075464_109907122	3300006805	Aqueous	MPNEITLYLIGVWCCVGLFTGAGWALGSWIVGRLLR*
Ga0075464_110500922	3300006805	Aqueous	MPATISLYLIGVWFCVGFFTGCGWALALWLVGRILSRV*
Ga0075428_1011836061	3300006844	Populus Rhizosphere	MPSTITLYQIGVWFCVGFFTGAGWAIAAWLVGRILRF*
Ga0075425_1000338266	3300006854	Populus Rhizosphere	MPSIVNVYLIGVWFCVGFFTGAGWAIAAWLVGRIFSHI*
Ga0075425_1003564172	3300006854	Populus Rhizosphere	MPNTITLYQVGVWTAVGFFTGAGWTLGAWLVARILR*
Ga0075425_1024915942	3300006854	Populus Rhizosphere	TINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI*
Ga0066797_11107212	3300006864	Soil	MPSKIDIYQIGVWFCVGFFTSAGWAFAAWLVGRILGFTHI*
Ga0075434_1013753642	3300006871	Populus Rhizosphere	MPSKIDLYQIGVWFCVGFFTGAGWAVAAWLVGRIFSHI*
Ga0075434_1017512752	3300006871	Populus Rhizosphere	MPSAVNLRLIGVWFCVGFFTGAGWAIAAWLVGRVLRF*
Ga0075434_1025379741	3300006871	Populus Rhizosphere	MPSTVNLYLIGVWFCVGFFTGAGWSIAAWIVGRILRF
Ga0073928_101925102	3300006893	Iron-Sulfur Acid Spring	MPSTINPRLIGVWFCVGFFTGAGWAIAAWLVGRILSAI*
Ga0073928_107301912	3300006893	Iron-Sulfur Acid Spring	MPSTINLYQIGVWFCVGFFTGAGWAVAAVLVGRILSVV*
Ga0073928_109866482	3300006893	Iron-Sulfur Acid Spring	MPSTVAPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI*
Ga0075424_1020538221	3300006904	Populus Rhizosphere	MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI*
Ga0079303_100547014	3300006930	Deep Subsurface	MPTTVTLYQIGVWFCVGFFTGVGWALGSWVVARILR*
Ga0075524_105401722	3300006950	Arctic Peat Soil	MPGESTMPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRILSLI*
Ga0099793_103502031	3300007258	Vadose Zone Soil	MPSVVNVYLIGVWFCVGFFTGAGWAIAAWLVGRIFSHI*
Ga0099793_107182381	3300007258	Vadose Zone Soil	MPSTINLHQIGIWFCVGFFTGAGWALAAWLVGRIFSHI*
Ga0099794_104902452	3300007265	Vadose Zone Soil	MPITVSLYLIGVWFCVGFFTGAGWAIAAWLVGRLLSRF*
Ga0099795_100145382	3300007788	Vadose Zone Soil	MPSTVTPYLIGVWFCVGFFPGAGWAVAAWLVGRILSYIHI*
Ga0102924_100034247	3300007982	Iron-Sulfur Acid Spring	MPSTINLYQIGVWFCVGFFTGAGWAIAGFLVARILTAV*
Ga0066793_100752535	3300009029	Prmafrost Soil	MPGESTMPSTINLQLILVWFCVGFFTGAGWAIAATLVGRILSVI*
Ga0099829_101411861	3300009038	Vadose Zone Soil	MPSTINLYQIGVWFCVGFFTGAGWALAAWLVGRIFSHI*
Ga0099829_102393392	3300009038	Vadose Zone Soil	MPSTINLYQIGVWAAVGFFTGAGWAFAGWLVGRIFSHI*
Ga0105095_105042411	3300009053	Freshwater Sediment	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRILRF*
Ga0099830_100547765	3300009088	Vadose Zone Soil	MPITVSLYLIGVWFCVGFFTGAGWAIAAWLVGRLLSRL*
Ga0099828_100130895	3300009089	Vadose Zone Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI*
Ga0099827_1000022013	3300009090	Vadose Zone Soil	MPSTINLHQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI*
Ga0099827_104532162	3300009090	Vadose Zone Soil	MPSIVNVYLIGVWFCVGFFTGAGWALAAWLVGRIFSHI*
Ga0105245_1000053112	3300009098	Miscanthus Rhizosphere	MPSTLTPYALLVWFCVGLFTGLGWACGAWLVGRILK*
Ga0066709_1011368192	3300009137	Grasslands Soil	MPSTVNLYQIGVWSAVGFFTGAGWAFAGWLIGRIFSHI*
Ga0105243_1000043022	3300009148	Miscanthus Rhizosphere	MPETVSLYAIGVWCCVGFFTGAGWSLGAWVIGRLLR*
Ga0111538_100507156	3300009156	Populus Rhizosphere	MPSTVNLYQIGVWFCVGFFTGAGWAVASWLVGRIFSHI*
Ga0111538_102597613	3300009156	Populus Rhizosphere	MPSTISLYVIGVWFAVGVFTGAGWAVGTWIVAKLTR*
Ga0075423_118678762	3300009162	Populus Rhizosphere	MPSTINLQLIGVWFCVGFFTGAGWAIAAWIVGRVLRF*
Ga0075423_123666332	3300009162	Populus Rhizosphere	MPSTINAYQIGVWFCVGFFTGAGWALAAWLVGRIFSHI*
Ga0105241_1000027263	3300009174	Corn Rhizosphere	MPETVTLYGIGVWTCVGFFTGAGWALASWLVSRITR*
Ga0105242_101204474	3300009176	Miscanthus Rhizosphere	MPTTITLYQLGVWTAVGFFTGAGWTLGAWLVARILR*
Ga0105242_101215224	3300009176	Miscanthus Rhizosphere	MPTTITLYQIGVWTAVGFFTGAGWTLGAWLVARILR*
Ga0105242_109016802	3300009176	Miscanthus Rhizosphere	MPSSINLRLIGVWFCVGFFTGAGWAIAAWLVGRVLRF*
Ga0116214_13651881	3300009520	Peatlands Soil	NMPSIVNLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV*
Ga0116218_15385782	3300009522	Peatlands Soil	GESNMPSTINLYQIGVWCAVGFFTGVGWAFAGWLVGRIFSHI*
Ga0116221_10673515	3300009523	Peatlands Soil	MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRILSVV*
Ga0116220_100256701	3300009525	Peatlands Soil	MPSTVNLYLIGVWFCVGFFTSAGWALAAWLVGRILSAV*
Ga0105249_119646862	3300009553	Switchgrass Rhizosphere	MPSAVNLYQIGVWFCVGFFTGAGWATAAWLVGRILRF*
Ga0116110_11716901	3300009643	Peatland	MPSKIDIYQIGVWFCVGFFTGAGWAIAGWLVGRILSVV*
Ga0105857_10239722	3300009650	Permafrost Soil	MPATVSLYLIGVWFCVGFFTGAGWAIAAWLVGRTLSRI*
Ga0105857_10829211	3300009650	Permafrost Soil	MPSKIDLYLIGVWFCVGFFTGAGWAIAAWLVGRILSAI*
Ga0105856_11048162	3300009662	Permafrost Soil	MPAKIDLYQIGVWFCVGFFTGAGWAIATWLVGRIFTAI*
Ga0116216_109552232	3300009698	Peatlands Soil	ESNMPSTVNLYLIGVWFCVGFFTSAGWALAAWLVGRILSAV*
Ga0116217_100420545	3300009700	Peatlands Soil	MPSTVNLYLIGVWFCVGFFTGAGWATATWLVGRILSIIHI*
Ga0116134_10752882	3300009764	Peatland	MPSTINLYQIGVWFCVGFFTGAGWAIAALLVGRILSAV*
Ga0105067_10714351	3300009812	Groundwater Sand	LVTQGESNMPSTINLYQIGVWFCVGFFTGAGWAIAAWIVGRILRF*
Ga0105087_10143322	3300009819	Groundwater Sand	MPSTINLYQIGVWFCVGFFTGAGWAIAAWIVGRILRF*
Ga0116223_105457292	3300009839	Peatlands Soil	MPSTINLYQIGVWFCVGFFTGAGWAIATVLVGRLLSAV*
Ga0116223_107531741	3300009839	Peatlands Soil	MPSKIDIYQIGVWFCVGFFTGAGWAIAGWLVGRIISVV*
Ga0126384_123387171	3300010046	Tropical Forest Soil	MPSTVNLNLIGVWFCVGFFTGAGWAIAAWLVGRILGHVL*
Ga0074044_107483871	3300010343	Bog Forest Soil	MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAV*
Ga0126372_116068532	3300010360	Tropical Forest Soil	MMNLILRGFMPSIVNLKLIGIWFCVGFFTGAGGAIAAWLVGRTLGRLV*
Ga0126381_1005420071	3300010376	Tropical Forest Soil	MPTKIDLYQIGVWFCVGFFAGAGWAIAGSLVGRIFSAV*
Ga0126381_1013714372	3300010376	Tropical Forest Soil	MPSKINPYQIGVWFCVGFFTSAGWAIAALLVGRILSPV*
Ga0136449_10004375012	3300010379	Peatlands Soil	MPSTINLYQIGVWCAVGFFTGVGWAFAGWLVGRIFSHI*
Ga0136449_1003355954	3300010379	Peatlands Soil	MPSIVNLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV*
Ga0136449_1004102083	3300010379	Peatlands Soil	MPSTINLYQIGVWCCVGFFTGAGWAFAAWLVGRIFSHI*
Ga0136449_1006828242	3300010379	Peatlands Soil	MPSAINLYQIGVWFSVGFFTGAGWAVAAWLVGRVLTAI*
Ga0136449_1007031272	3300010379	Peatlands Soil	MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRVLAAI*
Ga0136449_1008798282	3300010379	Peatlands Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAVLVGRILSAV*
Ga0136449_1016929703	3300010379	Peatlands Soil	MPSTVNLYQIGVWFCVGFFTGAGWAIAALLVGRTFSAV*
Ga0136449_1019834963	3300010379	Peatlands Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSVV*
Ga0136449_1032666411	3300010379	Peatlands Soil	MPSTINLYQIGVWCAVGFFTGAGWAFAAWLVGRIFSHI*
Ga0136449_1043662501	3300010379	Peatlands Soil	STINLYQIGVWFCVGFFTGAGWAVAAVLVGRILSAV*
Ga0134122_119974641	3300010400	Terrestrial Soil	MPDTVSLYAIGVWCCVGCFTGAGWSFGAWVIGRLCR*
Ga0134121_113447421	3300010401	Terrestrial Soil	MPNTIGWMQAGIWCAVGFCVGAGWTLGAWLVARILR*
Ga0134123_100011207	3300010403	Terrestrial Soil	MPNTITLYQVGVWVSVGFFTGAGWALGSWIVARILR*
Ga0134123_123899032	3300010403	Terrestrial Soil	MPSSINLRLIGVWFCVGFFTGAGWVIAAWLVGRVLRF*
Ga0126350_100275812	3300010880	Boreal Forest Soil	MPSTINPRLIGVWFCVGFFTGAGWAIAAWLVTRILTAI*
Ga0150983_129480072	3300011120	Forest Soil	MPSNINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI*
Ga0150983_132705302	3300011120	Forest Soil	MPSTINLYQIGVWFCVGFFTGAGWAVATVIVGRILSAI*
Ga0150983_135582604	3300011120	Forest Soil	MPSTVNPYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI*
Ga0150983_154444802	3300011120	Forest Soil	MPSNINLYQIGVWFCVGFFTGAGWAVAAWLVGRIFSAL*
Ga0137392_114136261	3300011269	Vadose Zone Soil	SQGESNMPSIVNVYLIGVWFCVGFFTGAGWAIAAWLVGRIFSHI*
Ga0137393_107340451	3300011271	Vadose Zone Soil	TINLYQIGVWFCVGFFTGAGWALAAWLVGRIFSHI*
Ga0137440_11371882	3300011410	Soil	MPSTITLYLIGVWFCVGFFTGAGWAIAAWLVGRILSRI*
Ga0137462_10066864	3300011421	Soil	MPSTITLYEIGVWFAVGFFTGAGWALASWIVNRIFR*
Ga0137443_10100053	3300011433	Soil	MPSKINVYQIGVWFCVGFFTGAGWAVAAWLVGRIFSRI*
Ga0137463_10823122	3300011444	Soil	MPSTVTLYQIGVWCCVGFFTGAGWTCGAWVISRLLR*
Ga0153929_10517373	3300012077	Attine Ant Fungus Gardens	MPSTINPYQIGVWFCVGFFTGAGWAIASLLVGRIFSAI*
Ga0153945_10615732	3300012150	Attine Ant Fungus Gardens	MPSTINLYQIGVWFCVGFFTGAGWAIASVIVGRILSVI*
Ga0137388_100737884	3300012189	Vadose Zone Soil	MPATVSLYLIGVWFCVGFVTGAGWAIAAWLVGRLLSRF*
Ga0137388_106694341	3300012189	Vadose Zone Soil	MPSIVNFYLFGVWFCVGFFTGAGWAIAAWLVGRIFSHI*
Ga0137363_113889842	3300012202	Vadose Zone Soil	STVNLYQIGVWSAVGFFTGAGWAFAGWLIGRIFSHI*
Ga0137362_108731792	3300012205	Vadose Zone Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLIGRIFSSI*
Ga0137379_100391976	3300012209	Vadose Zone Soil	MPSTINLRLIGIWFCVGFFTGAGWAIAALLVSRLLGRF*
Ga0137377_101710494	3300012211	Vadose Zone Soil	MPSKIDLYQIGVWFCVGFFTGAGWAVAGWLVGRIFSAI*
Ga0137449_11543511	3300012227	Soil	MPSKIDVYQIGVWFCVGFFTGAGWAIAAWLVGRILSRI*
Ga0137435_11033252	3300012232	Soil	MPTKLDVNLIAVWFCVGFFTGAGWAIAAWLVGRIFSHI*
Ga0137369_102871263	3300012355	Vadose Zone Soil	MPTAVNLKLIGVWFCVGFFTGAGWAIAAWLVGRTLGRLI*
Ga0137384_113598971	3300012357	Vadose Zone Soil	MPAKIDVYQIGVWFCVGFFTGAGWAVAGWLVGRIFSAI*
Ga0137360_112244271	3300012361	Vadose Zone Soil	MPSTINLYQIGVWCAVGFFTGAGWAFAGWLVGRIFSHI*
Ga0137390_105431464	3300012363	Vadose Zone Soil	MPTIVSLYLIGVWFCVGFFTGAGWAIAAWLVGRLLSRF*
Ga0137390_105489622	3300012363	Vadose Zone Soil	MPAIVSLYLIGVWFCVGFFTGAGWALAAWLVGRILSHA*
Ga0137398_104047821	3300012683	Vadose Zone Soil	TVTPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI*
Ga0137397_100707752	3300012685	Vadose Zone Soil	MPSTVTPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI*
Ga0137397_110966401	3300012685	Vadose Zone Soil	KGESNMPTTVNLQLIGVWFCVGFFAGAGWAVAAWLVARTLGRLL*
Ga0137395_104666141	3300012917	Vadose Zone Soil	MPSTINLYQIGVWSAVGFFTGAGWAFAGWLIGRIFSHI*
Ga0137359_113005922	3300012923	Vadose Zone Soil	MPSTINLHQIGVWFCVGFFTGAGWAIAAWLIGRIFSSI*
Ga0137359_117599901	3300012923	Vadose Zone Soil	MPSTVNLYQIGVWAAVGFFTGAGWAFAGWLVGRIFSHI*
Ga0137407_114178911	3300012930	Vadose Zone Soil	MPSTINVYQIGVWFCVGFFTGAGWAIAAWLVGRVLGRLV*
Ga0153915_119036471	3300012931	Freshwater Wetlands	MPSKIDIYQIGVWFCVGFFTGAGWAIASWLVGRIFSAI*
Ga0137410_117658002	3300012944	Vadose Zone Soil	MPTTVNLQLIGVWFCVGFFAGAGWAVATWLVARTLGRLL*
Ga0137410_119077281	3300012944	Vadose Zone Soil	MPSTINVYQIGVWFCVGFFTGAGWAIAGWLVGRVLGRLV*
Ga0126375_105555812	3300012948	Tropical Forest Soil	MPSTVNLNLIGVWFCVGFFTGAGWAIAAWLVGRVLGHVI*
Ga0126369_127086922	3300012971	Tropical Forest Soil	GHFRETHMPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFTHI*
Ga0120127_100034684	3300013503	Permafrost	MPSTINLQLILVWFCVGFFTGAGWAVATLLVGRILSVI*
Ga0120149_11601731	3300014058	Permafrost	MPSTVNLYLIGVWFCVGFFTGAGGAIATWLVGRIC
Ga0181521_104104492	3300014158	Bog	AYPQLIGVWFCVGFFTGAGWAIAAGLVGRILSVI*
Ga0181530_100187617	3300014159	Bog	MPSTVNLYQIGVWFCVGFFTGAGWAVAAFLVGRILSAV*
Ga0181532_100635171	3300014164	Bog	MPSTVNLYQIGVWFCVGFFTGAGWAIAGFLVARILTAV*
Ga0181532_102503683	3300014164	Bog	MPSTLTPQLIGVWFCVGLFTGAGWAIAAGLVGRIMSVI*
Ga0181523_104790491	3300014165	Bog	MPSKIDLYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAI*
Ga0181526_102202441	3300014200	Bog	MPSKIDIYQIGVWFCVGFFTGAGWAIAGWLVGRIGGGR
Ga0181526_105428372	3300014200	Bog	MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSIVHI*
Ga0182018_100233062	3300014489	Palsa	MPSTINLYQIGVWFCVGFFTGSGWAIATVLVGRLLSAV*
Ga0182018_102492042	3300014489	Palsa	MPSTVNPYLIGVWFCVGFFTGAGWAVATVIVGRVLSAI*
Ga0182018_102994572	3300014489	Palsa	MPSTINLHQIGVWFCVGFFTGAGWAVAAWLVGRVLTAI*
Ga0182013_100654562	3300014492	Bog	MPSTINLHLIGVWFCVGFFTGAGWAVATWLVGRIIFFI*
Ga0182015_102106052	3300014495	Palsa	MPSTIKLYQIGVWFCVGFFTSAGWAIAALLVGRILSTVLTQTSEG*
Ga0182024_1000298143	3300014501	Permafrost	MPSTVNLYLIGVWFCVGFFTGAGWTIAAWLVGRIFSIV*
Ga0182024_100402727	3300014501	Permafrost	MPSTVNLYLIGVWFCVGFFTGAGWAIATWLVGRVIFFI*
Ga0182024_101749676	3300014501	Permafrost	MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRILSAV*
Ga0182024_102584262	3300014501	Permafrost	MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRILSVI*
Ga0182024_116270572	3300014501	Permafrost	MPSTINLYQIGVWFCVGFFTGAGWAVAAWLVGRVLTAI*
Ga0181522_106699841	3300014657	Bog	MPSTINLYQIGVWFCVGFFTGAGWAIASVLVGRLLSVI*
Ga0182030_109967733	3300014838	Bog	MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFSVI*
Ga0180062_10057304	3300014879	Soil	RMLPTVITLYSALVWVVVGFCVGAGWTLGAWIVARILRSA*
Ga0167639_10001342	3300015080	Glacier Forefield Soil	MPTKFSLELIGVWFCVGFFTGAGWAVAAWLVGRVFSAI*
Ga0167642_10066512	3300015160	Glacier Forefield Soil	MPSTVDLYLIGVWFCVGFFTGAGWAVAAWLVGRILGIIHI*
Ga0132258_104673783	3300015371	Arabidopsis Rhizosphere	MPTKVNLELIIVWFCVGFFTGAGWAIATWLVGRILGLTHL*
Ga0182034_113177111	3300016371	Soil	RHSRETHMPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFTHI
Ga0182034_119170082	3300016371	Soil	MPTKIDLYQIGVWFCVGFFTSAGWATAGWLVGRIFSAFSAV
Ga0181515_10547601	3300016730	Peatland	RINMPSTVNLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV
Ga0187802_100014586	3300017822	Freshwater Sediment	MPSTINLYQIGVWFCVGFFTGAGWAIAALLVGRIFSTV
Ga0187818_103832031	3300017823	Freshwater Sediment	MPSTINLYQIGVWCSVGFFTGAGWAFAGWLVGRIFSHI
Ga0187856_10164456	3300017925	Peatland	MPSTINLYQIGVWFCVGFFTGAGWAIAAVLVGRILSAV
Ga0187856_10783201	3300017925	Peatland	MPSNINLYQIGVWFCVGFFTGAGWAIAALLVGRILSAV
Ga0187824_101030361	3300017927	Freshwater Sediment	MPSTINLYHIGVWFCVGFFTGAGWAIAALIVGRIFSAV
Ga0187853_100648753	3300017940	Peatland	MPSTVNLYQIGVWFCVGLFTGAGWAIAAFLVGRILSAV
Ga0187879_105017372	3300017946	Peatland	MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSVV
Ga0187817_100679041	3300017955	Freshwater Sediment	ESNMPSTINLYQIGVWFCVGFFTGAGWAIAALLVGRIFSTV
Ga0187781_101376082	3300017972	Tropical Peatland	MPSKIDLYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAI
Ga0187891_10374684	3300017996	Peatland	MPSTINLYQIGVWFCVGFFTGAGWAIAAVLVGRILSIV
Ga0187872_100368993	3300018017	Peatland	MPSKIDIYQIGVWFCVGFFTGAGWAIAGWLVGRILSVV
Ga0187874_103651962	3300018019	Peatland	MPSTVNLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV
Ga0187857_103066941	3300018026	Peatland	MPSTINLYQIGVWFCVGFFTGAGWAIAALLVGRILSAV
Ga0184605_100275292	3300018027	Groundwater Sediment	MPSTINLRLIGIWFCVGFFTGAGWSIAALIVSRLLGRL
Ga0187869_105137111	3300018030	Peatland	MPSTVNLYLIGVWFCVGFFTGAGWAIATWLVGRIIFFI
Ga0187887_104325141	3300018043	Peatland	PSLPGEFNMPSIVNLQLIGVWFCVGFFTGAGWAVATWLVGRIIFFI
Ga0184623_101047803	3300018056	Groundwater Sediment	SSSSPGESNMPATVNLYLLGVWFCVGFFTGSGWALAAWLVGRVLSRI
Ga0187858_104898642	3300018057	Peatland	MPSNINLYQIGVWFCVGFFTGAGWAIAALLVGRIFSAV
Ga0190272_116850132	3300018429	Soil	MPSAVNLYLIGVWFCVGFFTGAGWSIAAWLVGRILRF
Ga0190272_117990062	3300018429	Soil	MGLVANSADGEINMPSTITLYLIGVWFCVGFFAGAGWTLAARIISRVL
Ga0066662_101138962	3300018468	Grasslands Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLAGRIFSHV
Ga0190270_100919492	3300018469	Soil	MPSTINLYLIGVWFCVGFFTGAGWAIAAWLVGRIFSHM
Ga0190270_106785653	3300018469	Soil	MPSTITLYQIGVWFCVGFFTGAGWAIAAWLVGRILRF
Ga0190270_112619291	3300018469	Soil	MPAIVSLYLIGVWFCVGFFTGAGWALAAWLVGRILSHA
Ga0190274_106537104	3300018476	Soil	MPTTVSLYACGVWILVGVCTGAGWAFGHWLIGRLLTGVRTAG
Ga0190274_124124992	3300018476	Soil	MPSSVTLYLIGVWFCVGFFTGAGWAIAAWIVGRVLRF
Ga0193751_100009242	3300019888	Soil	MPSTINLHLIGVWFCVGFFTGAGWAVATWLVGRIIFFI
Ga0193751_100023339	3300019888	Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAVIVGRIFAHV
Ga0193751_10456573	3300019888	Soil	MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRISSAI
Ga0193745_10245972	3300020059	Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRVLGRLV
Ga0179590_10043363	3300020140	Vadose Zone Soil	MPSTVNPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI
Ga0179592_100032572	3300020199	Vadose Zone Soil	MPSTVTPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI
Ga0210407_106041563	3300020579	Soil	MPSTVNPYLIGVWFCVGFFTGAGWAVAGWLVGRILSYL
Ga0210407_106464222	3300020579	Soil	MPSTINLYQIGVWFCVGFFTGAGWAVAAVLVGRILSAV
Ga0210399_1000134922	3300020581	Soil	MPSTVNLYLIGVWFCVGFFTGAGWVIAAWLVGRILSIIHI
Ga0210399_103005272	3300020581	Soil	MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRVFSAI
Ga0210399_108179762	3300020581	Soil	MPSTVNPYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI
Ga0210395_100068105	3300020582	Soil	MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAI
Ga0210395_104177762	3300020582	Soil	MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSTI
Ga0210378_102555522	3300021073	Groundwater Sediment	ESNMPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI
Ga0179596_102489682	3300021086	Vadose Zone Soil	NMPSTVTPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYIHI
Ga0210404_102085053	3300021088	Soil	MPSTINLHQIGVWFCVGFFTGAGWAFAAWLIGRIFSHI
Ga0210377_100218246	3300021090	Groundwater Sediment	MPSKIDVYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI
Ga0210406_106243993	3300021168	Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVLLTVDTSPGRR
Ga0210400_115797951	3300021170	Soil	VPSTVNLYQIGVWFCVGFFTGAGWAIAAWLDGRVLSA
Ga0210405_106440651	3300021171	Soil	MPSTVNVKLIGVWFCVGFFTGAGWAVAAWLVGRVLSII
Ga0210405_107478572	3300021171	Soil	MPSTVNPYLIGVWFCVGFFTGAGWAVAAWLVGRILSII
Ga0210408_10000115122	3300021178	Soil	MPSTINLHQIGVWFCVGFFTGAGWAIAAVLVGRILSAV
Ga0210408_102852393	3300021178	Soil	MPSTVNLYQIGVWFCVGFFTGAGWAIASVIVGRIFAHI
Ga0210396_110588812	3300021180	Soil	MPATVNLHLIGVWFCVGFFTGAGWAVAAWLVGRVLPV
Ga0210396_112400252	3300021180	Soil	MPSTVNVYLIGVWFCVGFFTGAGWAVAGWVVGRVLSIL
Ga0193719_100241363	3300021344	Soil	MPSTINLRLIGIWFCVGFFTGAGWSIAALLVGRLLGRL
Ga0210393_104377781	3300021401	Soil	LSLQGESNMPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIVSAI
Ga0210393_110489462	3300021401	Soil	MPSTVNLHVIGVWFCVGFFTGAGWAVAAWLVGRVLSVIHI
Ga0210385_111642021	3300021402	Soil	MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRVFSVI
Ga0210389_101243852	3300021404	Soil	MPNTITLYQIGVWFCVGFFTGCGWALALWLVSRLLSRF
Ga0210387_117134102	3300021405	Soil	MPSTVNVYLIGVWFCVGFFTGTGWAVAAWLVGRILSIIHI
Ga0210386_102338242	3300021406	Soil	MPSTVNLHLIGVWFCVGFFTGAGWATAAWLVGRIISFI
Ga0210386_104582612	3300021406	Soil	MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRVLGIIHI
Ga0210383_108767043	3300021407	Soil	STVNVYLIGVWFCVGFFTGAGWAAAGWLVGRVLSIL
Ga0210383_111766741	3300021407	Soil	GSNMPSTINLYQIGVWFCVGFFTGAGWAVAAVLVGRILSAV
Ga0210394_102891311	3300021420	Soil	KFNTPSTVNPHLIGVWFSVGFFTGAGWAVAAWLVGRILSYIHV
Ga0210390_111790361	3300021474	Soil	MPSTVNLQLIGVWFCVGFFTGAGWAVAAWLVGRVLSVIHI
Ga0210390_116179681	3300021474	Soil	AITTGRESNMPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAI
Ga0210398_112955111	3300021477	Soil	INLYQIGVWFCVGFFTGAGWAVAAWLVGRVLSVIHI
Ga0210402_120254651	3300021478	Soil	MPTTVSLYLIGVWFCVGFFTGAGWAIANWLIGRVLSRI
Ga0210410_100931452	3300021479	Soil	SLQGESKMPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAI
Ga0210410_107001381	3300021479	Soil	MPSTVNPYLIGVWFCVGFFTGAGWAVAAWLVGRILSYVHI
Ga0210409_114455522	3300021559	Soil	ESNMPSTINLHQIGVWFCVGFFTGAGWAFAAWLIGRIFSHI
Ga0212124_107475752	3300022553	Freshwater	MGFLDFMPNAITLYDAAIWFVVGLCTGAGWALGAWLIARVLR
Ga0212123_101774152	3300022557	Iron-Sulfur Acid Spring	MPSTINPRLIGVWFCVGFFTGAGWAIAAWLVGRILSAI
Ga0212123_103899072	3300022557	Iron-Sulfur Acid Spring	MPSTINLYQIGVWFCVGFFTGAGWAIAGFLVARILTAV
Ga0242654_104100512	3300022726	Soil	ASPQGESNMPSTINLHQIGVWFCVGFFTGAGWAFAAWLIGRIFSHI
Ga0247785_10356322	3300022889	Soil	MPNDITLYLFGVWFCVGFITGAGWALGSWIIGRLLR
Ga0179591_10283967	3300024347	Vadose Zone Soil	MPSTVNLHQIGVWFCVGFFTGAGWASAAWLVGRILRF
Ga0208850_10030173	3300025457	Arctic Peat Soil	MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFSII
Ga0208850_10062994	3300025457	Arctic Peat Soil	MPSKIDIYQIGVWFCVGFFTSAGWAFAAWLVGRILGFTHI
Ga0208850_10083794	3300025457	Arctic Peat Soil	MPSTVNLQLILVWFCVGFFTGAGWAIAAWLVGRILSVI
Ga0208850_10218554	3300025457	Arctic Peat Soil	MPGESTMPSTINLQLILVWFCVGFFTGAGWAIAATLVGRILSVI
Ga0208850_10262392	3300025457	Arctic Peat Soil	MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRILSAI
Ga0208076_10143001	3300025464	Arctic Peat Soil	MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFSVI
Ga0208079_10593741	3300025481	Arctic Peat Soil	MPSTINVQLIGVWFCVGFFTGAGWAIAAWLVGRILSAI
Ga0207929_10005522	3300025505	Arctic Peat Soil	MPTKLNLELIGVWFCVGFFTGAGWAVATWLVGRIFSAI
Ga0208714_10248482	3300025527	Arctic Peat Soil	MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI
Ga0208078_10336513	3300025544	Arctic Peat Soil	TVNLYLIGVWFCVGFFTGAGWAIATWLVGRIIFFI
Ga0208080_10458461	3300025553	Arctic Peat Soil	LIIPGESTMPSTINLQLILVWFCVGFFTGAGWAIAATLVGRILSVI
Ga0208355_10796582	3300025581	Arctic Peat Soil	MPSTLNLQLILVWFCVGFFTGAGWAIAAWLVGRILSVI
Ga0208219_10142432	3300025625	Arctic Peat Soil	MPSTINLQLIGVWFCVGFFTGAGWAIAASLVGRIFSVI
Ga0209176_100035391	3300025854	Arctic Peat Soil	MPMTITLYLLGVWFCVGFFTGAGWFIASWLVTRLLSKLA
Ga0209585_101712881	3300025891	Arctic Peat Soil	MPTKLNLELISVWFCVGFFTGAGWAIATWLVGRILTAI
Ga0209585_103396032	3300025891	Arctic Peat Soil	MPGESTMPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRILSLI
Ga0208916_103825273	3300025896	Aqueous	MPNTITLYQIGVWCCVGFFTGACWTLGARFIARILR
Ga0208916_104401531	3300025896	Aqueous	MPNTITLYQIGVWCCVGFFTGAGWTLGAWLIARILR
Ga0207684_113576501	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MPSKIDVYLIGVWFCVGFFTGAGWAVAAWLVGRILSVI
Ga0207654_1000018613	3300025911	Corn Rhizosphere	MPETVTLYGIGVWTCVGFFTGAGWALASWLVSRITR
Ga0207693_108536742	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MPSTVNLYQIGVWCAVGFFTGAGWAFAGWLIGRIFSHI
Ga0207650_108378641	3300025925	Switchgrass Rhizosphere	MPSTVNLHQIGVWFCVGFFTGAGWAIAAWLVGRILR
Ga0207687_1000090612	3300025927	Miscanthus Rhizosphere	MPSTLTPYALLVWFCVGLFTGLGWACGAWLVGRILK
Ga0207686_1000030640	3300025934	Miscanthus Rhizosphere	MPTTITLYQIGVWTAVGFFTGAGWTLGAWLVARILR
Ga0207686_100024791	3300025934	Miscanthus Rhizosphere	MPTTITLYQLGVWTAVGFFTGAGWTLGAWLVARILR
Ga0207686_109036212	3300025934	Miscanthus Rhizosphere	MPSSINLRLIGVWFCVGFFTGAGWAIAAWLVGRVLRF
Ga0207709_1000038762	3300025935	Miscanthus Rhizosphere	MPETVSLYAIGVWCCVGFFTGAGWSLGAWVIGRLLR
Ga0207712_100328878	3300025961	Switchgrass Rhizosphere	MPVTVTLYLIGVWFCVGFFTGAGWAIASWLVGRVGSRVG
Ga0207712_120479401	3300025961	Switchgrass Rhizosphere	MPSAVNLYQIGVWFCVGFFTGAGWAIAAWLVGRILRF
Ga0207702_109714743	3300026078	Corn Rhizosphere	SKIDLYQIGVWFCVGFFTGSGWAVGAWIVGRVFSAI
Ga0209855_10397542	3300026220	Permafrost Soil	MPATVSLYLIGVWFCVGFFTGAGWAIAAWLVGRTLSRI
Ga0209027_10722382	3300026300	Grasslands Soil	MPSTINLRLIGTWFCVGFFTGAGWSIAALIVSRLLGRL
Ga0209419_10256711	3300027537	Forest Soil	MPSTINLYQIGVWFCVGFFTGAGWAIASVIVGRIFAHI
Ga0209220_11900171	3300027587	Forest Soil	MEIDMPMTITLYLIGVWFCVGFFAGAGWTLAAHLIGRL
Ga0209331_10688242	3300027603	Forest Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSHV
Ga0209422_10841182	3300027629	Forest Soil	MPSTVNLHLIGVWFCVGFFAGAGWAIAAVLVGRILSAV
Ga0209420_10007599	3300027648	Forest Soil	MPSTINLYQIGVWFCVGFFTGAGWAIASVLVGRVLSVI
Ga0209011_10440443	3300027678	Forest Soil	MPATVSLYLIGVWFCVGFFTGAGWAIATWLVGRTLSRI
Ga0209626_10693661	3300027684	Forest Soil	MPSKIDVYQIGVWFCVGFFTGAGWAIAGWLVGRIFS
Ga0208665_100386764	3300027715	Deep Subsurface	MPTTVTLYQIGVWFCVGFFTGVGWALGSWVVARILR
Ga0209261_100131031	3300027735	Wetland Sediment	MPSTITLYQIGVWFCVGFFTGTGWVLGAWVVGRILRF
Ga0209448_101275751	3300027783	Bog Forest Soil	MPSKIDAYQIGVWFCVGFFTGAGWATAGWLVGRIFSAI
Ga0209514_102363331	3300027819	Groundwater	MPSTINVYQIGVWFCVGFFTGAGWAIAAWLVGRILSRI
Ga0209514_102388933	3300027819	Groundwater	MPSKIDVYQIGVWFCVGFFTGAGWAIAAWLVGRILSRI
Ga0209514_102728252	3300027819	Groundwater	MPATVNLYLIGVWFCVGFFTGSGWAVAAWLVGRVLSHV
Ga0209060_100007606	3300027826	Surface Soil	MPSKIDLHLIGIWFCVGFFTGAGWAIATWLVGRILSVI
Ga0209515_105041962	3300027835	Groundwater	MPSTINLYQIGVWFCVGFFTGSGWAIAAWLVGRVLRF
Ga0209515_105987642	3300027835	Groundwater	MPSKIDVYQIGVWFCVGFFTGAGWAIAAWLVGRVFSHI
Ga0209180_102260461	3300027846	Vadose Zone Soil	MPSTINLYQIGVWFCVGFFTGAGWALAAWLVGRIFSHI
Ga0209517_100659065	3300027854	Peatlands Soil	MPSTVNLYLIGVWFCVGFFTGAGWATATWLVGRILSIIHI
Ga0209701_104194843	3300027862	Vadose Zone Soil	DRNMPITVSLYLIGVWFCVGFFTGAGWAIAAWLVGRLLSRL
Ga0209813_101685782	3300027866	Populus Endosphere	MPSTVNLYLIGVWFCVGFFTGAGWSIAAWLVGRILRF
Ga0209167_1000012667	3300027867	Surface Soil	MPSTVNLYLIGVWFCVGFFTGAGWATAAWLVGRILSIIHI
Ga0209167_100001423	3300027867	Surface Soil	MPSTVNLHLIGVWFCVGFFTGAGWAAATWLVGRIISFI
Ga0209590_100192482	3300027882	Vadose Zone Soil	MPSTINLHQIGVWFCVGFFTGAGWAIAAWLVGRIFSHI
Ga0209590_100585813	3300027882	Vadose Zone Soil	MPITVSLYLIGVWFCVGFFTGAGWAIAAWLVGRLLSRF
Ga0209380_105343601	3300027889	Soil	MPSTVNVYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI
Ga0209068_1000122613	3300027894	Watersheds	MPSAVNVYLIGVWFCVGFFTGAGWAVAAWLVGRILNAI
Ga0209624_100191015	3300027895	Forest Soil	MPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILGIIHI
Ga0209048_1000000413	3300027902	Freshwater Lake Sediment	MPTTISLYQFGIWFCVGFSTGAGWTIAAWLVGRIGTKVA
Ga0209048_100367415	3300027902	Freshwater Lake Sediment	MPSTITLYLIGIWFCVGFFAGAGWAIAAWLVGRISSYI
Ga0209048_100545593	3300027902	Freshwater Lake Sediment	MPSKIDLYLIGVWFCVGFFTGAGWAIAAWLVGRIFSAI
Ga0209488_107102622	3300027903	Vadose Zone Soil	MPTTVSLYLIGVWFCVGFFTGAGWAIAAWLVGRTLSRI
Ga0209415_101941882	3300027905	Peatlands Soil	MPSTVNLYQIGVWFCVGFFTGAGWAIAALLVGRILSAV
Ga0209006_100082855	3300027908	Forest Soil	MPSTINIHLIGVWFCVGFFTGAGWAIAAWLVARILTAL
Ga0209006_104814001	3300027908	Forest Soil	MPSTINLQLIGVWFCVGFFTGAGWAVAAWIVGRILTAI
Ga0209006_106553392	3300027908	Forest Soil	MPSTVNPYLIGVWFCVGFFTSAGWAVAAWFVGRILSYIHV
Ga0209006_111708281	3300027908	Forest Soil	MPSTINLHLIGVWFCVGFFTGAGWAIAAWLVARILTAI
Ga0209583_103238442	3300027910	Watersheds	MPSKIDVYQIGVWFCVGFFTGAGWAVAGWLVGRIFSAI
Ga0209698_102251802	3300027911	Watersheds	MPSTINPYLIGVWFCVGFFTGAGWAVAAWLVGRVLSAI
Ga0209698_110724011	3300027911	Watersheds	FNMPSTVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSLIHI
Ga0209526_100142552	3300028047	Forest Soil	MPATVSLYLIGVWFCVGFFTGAGWAIAAWLVGRTLSRL
Ga0209526_108900371	3300028047	Forest Soil	MPSTVNVYLIGVWFCVGFFTGAGWAVAAWLVGRVLAVI
Ga0307301_102997231	3300028719	Soil	LPSTINLYQIGVWFCVGFFTGAGWAVAAWLVGRIFSHV
Ga0308309_115369231	3300028906	Soil	MPSTVNPYLLGVWFCVGSFTGAGWAVAAWLVGRILSYIHI
Ga0302046_109804041	3300030620	Soil	MPSTIKLYLIGVWFCVGFFTGAGWAIAAWLVGRVLANI
Ga0170834_1086721572	3300031057	Forest Soil	MPSTINVQLIGVWFCVGFFTGAGWAIAAWLVARILSAL
Ga0307497_102290032	3300031226	Soil	MPSTINIYQIGVWFCVGFFTGAGWAIAGWLVGRIFSHI
Ga0170824_1051246202	3300031231	Forest Soil	MPSTINLYQIGVWFCVGFFTGVGWAIAALLVGRIFSAV
Ga0302325_120390432	3300031234	Palsa	KMPSTVNLYLVGVWFCVGFFTGAGWAVAAWLMGRILSIIHI
Ga0265325_1000002990	3300031241	Rhizosphere	MPIKVNLELIIVWFCVGFFTGAGWAIATWLVGRILGLTHL
Ga0307442_10968011	3300031274	Salt Marsh	MPSKIDLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSAI
Ga0170820_126389442	3300031446	Forest Soil	MPSKINLYQIGVWFCVRFFTSAGWAVAALLVGRILFAV
Ga0170818_1106234261	3300031474	Forest Soil	MPSKIDLYQIGVWFCVGFFTGAGWAIAGWLVGRISSAI
Ga0310887_106692812	3300031547	Soil	ITTWRIHMPSTINLYQVGVWFCVGFFTGAGWAIAAWLVGRIFSHI
Ga0310686_10224404724	3300031708	Soil	MPSAVNLYLIGVWFCVGFFTGAGWAVAAWLVGRILSIIHI
Ga0310686_10404439332	3300031708	Soil	MPSTVNLHLVGVWFCVGFFTGAGWAVATWLVGRIIFFI
Ga0310686_1071862961	3300031708	Soil	MMPSNINLYQIGVWFCVGFFTGAGWALAAWLVGRIFSHI
Ga0310686_1073731752	3300031708	Soil	MPSTINLYQVGVWFCVGFFTGAGWAVAAWLVGRVMTAI
Ga0310686_1170683992	3300031708	Soil	MPSTVNPYLLGVWFCVGFFTGAGWAVAAWLVGRILSYIHV
Ga0310686_1179926252	3300031708	Soil	MPSTINLYQIRVWFCVGFFTGAGWAIAALLVGRTFSAV
Ga0307468_1022114611	3300031740	Hardwood Forest Soil	MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRVLGRLV
Ga0306918_108775072	3300031744	Soil	MPTKIDLYQIGVWFCVGFFTSAGWAIAGWLVGRIFSAV
Ga0307477_1000193816	3300031753	Hardwood Forest Soil	MPSIVSLYLIAVWFCVGFFTGAGWMLGARIIGKLL
Ga0307477_101002281	3300031753	Hardwood Forest Soil	MPSTVNLYLIGVWFCVGFFTGAGWAIASVIVGRVFAHV
Ga0307475_103468782	3300031754	Hardwood Forest Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFTHI
Ga0307478_110701051	3300031823	Hardwood Forest Soil	MPSKIDAYQVGVWFCVGFFTGAGWAIAGWLVGRILSVI
Ga0307478_115371962	3300031823	Hardwood Forest Soil	MPPKIDLYQIGVWFCVGFFTGAGWAIAGWLVGRIFSAV
Ga0310900_113181162	3300031908	Soil	MPNDITLSQCGVWFCVGFFTGGGWAFAQWVIGRLR
Ga0306923_124683901	3300031910	Soil	MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFTH
Ga0214473_100815786	3300031949	Soil	MPSTVKLYLIGVWFCVGFFTGAGWAVAAWLVGRVLSNI
Ga0214473_112270271	3300031949	Soil	MPSTINLYLIGVWFCVGFFTGAGWAIATWLVGRIFSHI
Ga0214473_118046722	3300031949	Soil	MPAIVNLYLIGVWFCVGFFTGAGWAIAAWLVGRIFSHI
Ga0315540_102749352	3300032061	Salt Marsh Sediment	EGYNMPSKIDLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSAI
Ga0318540_103836832	3300032094	Soil	STINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFTHI
Ga0311301_101698655	3300032160	Peatlands Soil	MPSTINLYQIGVWFCVGFFTGAGWAIATVLVGRLLSAV
Ga0311301_102235923	3300032160	Peatlands Soil	MPSAINLYQIGVWFSVGFFTGAGWAVAAWLVGRVLTAI
Ga0311301_103663444	3300032160	Peatlands Soil	MPSTINLQLILVWFCVGFFTGAGWAIAATLVGRILSVI
Ga0311301_109407222	3300032160	Peatlands Soil	MPSTVNLYQIGVWFCVGFFTGAGWAIAAWLVGRVLAAI
Ga0311301_117633032	3300032160	Peatlands Soil	MPSTINLYQIGVWCCVGFFTGAGWAFAAWLVGRIFSHI
Ga0311301_117658891	3300032160	Peatlands Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRIFSVV
Ga0311301_118164502	3300032160	Peatlands Soil	MPSTINLHQIGVWFCVGFFTGAGWAVAAWLVGRVLTAI
Ga0307470_101426252	3300032174	Hardwood Forest Soil	MPSTIILYQIGVWFCVGFFTGAGWAIAAWLVGRILRF
Ga0307470_103065721	3300032174	Hardwood Forest Soil	MPSTVNLNLIGVWFCVGFFTGAGWAIAAWLVGRILGRLI
Ga0307470_106181542	3300032174	Hardwood Forest Soil	MPTKVNLELIMVWFCVGFFTGAGWAVATWLVGRILG
Ga0307471_1011666801	3300032180	Hardwood Forest Soil	PSTVNLNLIGVWFCVGFFTGAGWAIAAWLVGRILGRLI
Ga0306920_1012112652	3300032261	Soil	MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRIFTHI
Ga0315742_133611321	3300032756	Forest Soil	STVNLYQIGVWFCVGFFTGAGWAIATVLVGRILSVV
Ga0335084_102680702	3300033004	Soil	MPSTVNLNLIGVWFCVGFFTGAGWAIASWLVGRVLGHVI
Ga0316624_100157944	3300033486	Soil	MPSKIDLYQIGVWFCVGFFTGAGWAIAAWLVGRISSAI
Ga0334790_004379_8568_8684	3300033887	Soil	MPSTINLQLIGVWFCVGFFTGAGWAIAAWLVGRILSVI
Ga0334790_198528_66_182	3300033887	Soil	MPSTINLYQIGVWFCVGFFTGAGWAIAAWLVGRILSAV
Ga0334792_000440_5476_5592	3300033888	Soil	MPTKFSLELIGVWFCVGFFTGAGWAVATWLVGRIFSAI
Ga0326723_0190778_552_668	3300034090	Peat Soil	MPSTINLYQIGVWFCVGFFTGAGWGIAGWLVGRIFSHI
Ga0370483_0224628_245_361	3300034124	Untreated Peat Soil	MPSIVNLQLSGVWFCVGFFTGAGWAVATWLVGRIIFFI
Ga0364929_0202413_225_338	3300034149	Sediment	MPSAVNLYQIGVWFCVGFFTGAGWATAAWLVGRVLRF
Ga0370498_063852_251_364	3300034155	Untreated Peat Soil	MPTTVSLYLIGVWFCVGFFTGAGWAIAAWLVGRVLRF
Ga0370507_0275738_42_155	3300034158	Untreated Peat Soil	MPTTVSLYLIGVWFCVGFFTGAGWAIAAWLVGRDLRF