NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F004207

Metagenome Family F004207

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F004207
Family Type Metagenome
Number of Sequences 448
Average Sequence Length 36 residues
Representative Sequence LSVTLFEKTPILQALQASDSDTDLLDPGNQLILFDF
Number of Associated Samples 267
Number of Associated Scaffolds 448

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.67 %
% of genes near scaffold ends (potentially truncated) 98.44 %
% of genes from short scaffolds (< 2000 bps) 67.86 %
Associated GOLD sequencing projects 252
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (66.518 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(8.036 % of family members)
Environment Ontology (ENVO) Unclassified
(31.250 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.759 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.00%    β-sheet: 0.00%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 448 Family Scaffolds
PF00589Phage_integrase 1.34
PF14294DUF4372 1.12
PF12728HTH_17 0.89
PF01850PIN 0.67
PF08241Methyltransf_11 0.67
PF00171Aldedh 0.67
PF13470PIN_3 0.67
PF08281Sigma70_r4_2 0.67
PF00535Glycos_transf_2 0.67
PF13683rve_3 0.67
PF13620CarboxypepD_reg 0.67
PF13692Glyco_trans_1_4 0.67
PF01381HTH_3 0.67
PF01610DDE_Tnp_ISL3 0.67
PF13649Methyltransf_25 0.67
PF01609DDE_Tnp_1 0.67
PF01436NHL 0.45
PF14659Phage_int_SAM_3 0.45
PF00837T4_deiodinase 0.45
PF00005ABC_tran 0.45
PF16640Big_3_5 0.45
PF02321OEP 0.45
PF02518HATPase_c 0.45
PF13638PIN_4 0.45
PF01370Epimerase 0.45
PF01425Amidase 0.45
PF02397Bac_transf 0.45
PF00270DEAD 0.45
PF13517FG-GAP_3 0.45
PF07592DDE_Tnp_ISAZ013 0.45
PF12543DUF3738 0.45
PF13546DDE_5 0.45
PF00328His_Phos_2 0.45
PF07729FCD 0.45
PF13088BNR_2 0.45
PF04365BrnT_toxin 0.45
PF00872Transposase_mut 0.45
PF03992ABM 0.45
PF13676TIR_2 0.45
PF13340DUF4096 0.45
PF00483NTP_transferase 0.45
PF00106adh_short 0.45
PF00665rve 0.45
PF14522Cytochrome_C7 0.45
PF07494Reg_prop 0.45
PF13356Arm-DNA-bind_3 0.22
PF05193Peptidase_M16_C 0.22
PF13421Band_7_1 0.22
PF13561adh_short_C2 0.22
PF00873ACR_tran 0.22
PF00149Metallophos 0.22
PF07728AAA_5 0.22
PF01979Amidohydro_1 0.22
PF13610DDE_Tnp_IS240 0.22
PF13439Glyco_transf_4 0.22
PF13578Methyltransf_24 0.22
PF13472Lipase_GDSL_2 0.22
PF13602ADH_zinc_N_2 0.22
PF00578AhpC-TSA 0.22
PF01593Amino_oxidase 0.22
PF01522Polysacc_deac_1 0.22
PF13565HTH_32 0.22
PF07075DUF1343 0.22
PF12631MnmE_helical 0.22
PF00970FAD_binding_6 0.22
PF12770CHAT 0.22
PF02371Transposase_20 0.22
PF14559TPR_19 0.22
PF13385Laminin_G_3 0.22
PF01909NTP_transf_2 0.22
PF16347DUF4976 0.22
PF04389Peptidase_M28 0.22
PF02195ParBc 0.22
PF04796RepA_C 0.22
PF07313DUF1460 0.22
PF06067DUF932 0.22
PF00144Beta-lactamase 0.22
PF10091Glycoamylase 0.22
PF13005zf-IS66 0.22
PF04008Adenosine_kin 0.22
PF02223Thymidylate_kin 0.22
PF00675Peptidase_M16 0.22
PF01833TIG 0.22
PF03706LPG_synthase_TM 0.22
PF13271DUF4062 0.22
PF01053Cys_Met_Meta_PP 0.22
PF00480ROK 0.22
PF00348polyprenyl_synt 0.22
PF02574S-methyl_trans 0.22
PF01204Trehalase 0.22
PF01548DEDD_Tnp_IS110 0.22
PF13231PMT_2 0.22
PF01098FTSW_RODA_SPOVE 0.22
PF01797Y1_Tnp 0.22
PF13411MerR_1 0.22
PF05239PRC 0.22
PF00078RVT_1 0.22
PF13493DUF4118 0.22
PF01641SelR 0.22
PF00148Oxidored_nitro 0.22
PF02470MlaD 0.22
PF03332PMM 0.22
PF14319Zn_Tnp_IS91 0.22
PF01184Gpr1_Fun34_YaaH 0.22
PF08483Obsolete Pfam Family 0.22
PF07238PilZ 0.22
PF13175AAA_15 0.22
PF13384HTH_23 0.22
PF07642BBP2 0.22
PF01526DDE_Tnp_Tn3 0.22
PF05128DUF697 0.22
PF14602Hexapep_2 0.22
PF12840HTH_20 0.22
PF12704MacB_PCD 0.22
PF02591zf-RING_7 0.22
PF00881Nitroreductase 0.22
PF03400DDE_Tnp_IS1 0.22
PF06250YhcG_C 0.22
PF00083Sugar_tr 0.22
PF03441FAD_binding_7 0.22
PF03720UDPG_MGDP_dh_C 0.22
PF01637ATPase_2 0.22
PF02685Glucokinase 0.22
PF08808RES 0.22
PF00072Response_reg 0.22
PF09957VapB_antitoxin 0.22
PF02511Thy1 0.22
PF01555N6_N4_Mtase 0.22
PF06736TMEM175 0.22
PF00962A_deaminase 0.22
PF01523PmbA_TldD 0.22
PF09721Exosortase_EpsH 0.22
PF13646HEAT_2 0.22
PF00255GSHPx 0.22
PF00486Trans_reg_C 0.22
PF05168HEPN 0.22
PF02880PGM_PMM_III 0.22
PF13466STAS_2 0.22
PF04972BON 0.22
PF11154DUF2934 0.22
PF08450SGL 0.22
PF00528BPD_transp_1 0.22
PF01408GFO_IDH_MocA 0.22
PF13614AAA_31 0.22
PF00430ATP-synt_B 0.22
PF00239Resolvase 0.22
PF13484Fer4_16 0.22
PF01757Acyl_transf_3 0.22
PF01208URO-D 0.22
PF02357NusG 0.22
PF07638Sigma70_ECF 0.22
PF13450NAD_binding_8 0.22
PF00753Lactamase_B 0.22
PF06739SBBP 0.22
PF07690MFS_1 0.22
PF08447PAS_3 0.22
PF01814Hemerythrin 0.22
PF05853BKACE 0.22
PF06155GBBH-like_N 0.22
PF13490zf-HC2 0.22
PF01790LGT 0.22
PF02604PhdYeFM_antitox 0.22
PF12831FAD_oxidored 0.22
PF13682CZB 0.22
PF13091PLDc_2 0.22
PF00923TAL_FSA 0.22
PF01112Asparaginase_2 0.22
PF01116F_bP_aldolase 0.22
PF14509GH97_C 0.22
PF13476AAA_23 0.22
PF00195Chal_sti_synt_N 0.22
PF13180PDZ_2 0.22
PF01966HD 0.22
PF00135COesterase 0.22
PF13701DDE_Tnp_1_4 0.22
PF01435Peptidase_M48 0.22
PF13431TPR_17 0.22
PF02661Fic 0.22
PF03235DUF262 0.22
PF14478DUF4430 0.22
PF00877NLPC_P60 0.22
PF10067DUF2306 0.22
PF02449Glyco_hydro_42 0.22
PF08448PAS_4 0.22
PF01695IstB_IS21 0.22
PF00154RecA 0.22
PF13655RVT_N 0.22
PF14748P5CR_dimer 0.22
PF01261AP_endonuc_2 0.22
PF00593TonB_dep_Rec 0.22
PF07676PD40 0.22
PF13751DDE_Tnp_1_6 0.22
PF00082Peptidase_S8 0.22
PF00295Glyco_hydro_28 0.22
PF05711TylF 0.22
PF10042DUF2278 0.22
PF03466LysR_substrate 0.22
PF13365Trypsin_2 0.22
PF00702Hydrolase 0.22
PF08543Phos_pyr_kin 0.22

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 448 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 0.89
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.67
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.67
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.67
COG3293TransposaseMobilome: prophages, transposons [X] 0.67
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.67
COG3464TransposaseMobilome: prophages, transposons [X] 0.67
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.67
COG5421TransposaseMobilome: prophages, transposons [X] 0.67
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.67
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.67
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.45
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.45
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 0.45
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 0.45
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.45
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.45
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.45
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.45
COG3292Periplasmic ligand-binding sensor domainSignal transduction mechanisms [T] 0.45
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.45
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.45
COG3547TransposaseMobilome: prophages, transposons [X] 0.45
COG4584TransposaseMobilome: prophages, transposons [X] 0.45
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 0.22
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.22
COG0125Thymidylate kinaseNucleotide transport and metabolism [F] 0.22
COG0142Geranylgeranyl pyrophosphate synthaseCoenzyme transport and metabolism [H] 0.22
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.22
COG0176Transaldolase/fructose-6-phosphate aldolaseCarbohydrate transport and metabolism [G] 0.22
COG0191Fructose/tagatose bisphosphate aldolaseCarbohydrate transport and metabolism [G] 0.22
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.22
COG0250Transcription termination/antitermination protein NusGTranscription [K] 0.22
COG0312Zn-dependent protease PmbA/TldA or its inactivated homologGeneral function prediction only [R] 0.22
COG03323-oxoacyl-[acyl-carrier-protein] synthase IIILipid transport and metabolism [I] 0.22
COG0351Hydroxymethylpyrimidine/phosphomethylpyrimidine kinaseCoenzyme transport and metabolism [H] 0.22
COG0386Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxidesDefense mechanisms [V] 0.22
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.22
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.22
COG0407Uroporphyrinogen-III decarboxylase HemECoenzyme transport and metabolism [H] 0.22
COG0415Deoxyribodipyrimidine photolyaseReplication, recombination and repair [L] 0.22
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.22
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 0.22
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.22
COG0524Sugar or nucleoside kinase, ribokinase familyCarbohydrate transport and metabolism [G] 0.22
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.22
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.22
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.22
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.22
COG0711FoF1-type ATP synthase, membrane subunit b or b'Energy production and conversion [C] 0.22
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.22
COG0772Peptodoglycan polymerase FtsW/RodA/SpoVECell cycle control, cell division, chromosome partitioning [D] 0.22
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 0.22
COG0837GlucokinaseCarbohydrate transport and metabolism [G] 0.22
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.22
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.22
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 0.22
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 0.22
COG1373Predicted ATPase, AAA+ superfamilyGeneral function prediction only [R] 0.22
COG1446Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamilyAmino acid transport and metabolism [E] 0.22
COG1479DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domainsDefense mechanisms [V] 0.22
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.22
COG1579Predicted nucleic acid-binding protein DR0291, contains C4-type Zn-ribbon domainGeneral function prediction only [R] 0.22
COG1584Succinate-acetate transporter SatPEnergy production and conversion [C] 0.22
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.22
COG1626Neutral trehalaseCarbohydrate transport and metabolism [G] 0.22
COG1662Transposase and inactivated derivatives, IS1 familyMobilome: prophages, transposons [X] 0.22
COG1672Predicted ATPase, archaeal AAA+ ATPase superfamilyGeneral function prediction only [R] 0.22
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.22
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.22
COG1816Adenosine/6-amino-6-deoxyfutalosine deaminaseNucleotide transport and metabolism [F] 0.22
COG1839Adenosine/AMP kinaseNucleotide transport and metabolism [F] 0.22
COG1874Beta-galactosidase GanACarbohydrate transport and metabolism [G] 0.22
COG1895HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.22
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.22
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.22
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.22
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.22
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.22
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.22
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.22
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.22
COG2240Pyridoxal/pyridoxine/pyridoxamine kinaseCoenzyme transport and metabolism [H] 0.22
COG2250HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.22
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.22
COG2367Beta-lactamase class ADefense mechanisms [V] 0.22
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.22
COG2710Nitrogenase Mo-Fe protein NifD/coenzyme F430 biosynthesis subunit CfbDCoenzyme transport and metabolism [H] 0.22
COG2870ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferaseCell wall/membrane/envelope biogenesis [M] 0.22
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.22
COG3246Uncharacterized conserved protein, DUF849 familyFunction unknown [S] 0.22
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.22
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.22
COG3424Predicted naringenin-chalcone synthaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.22
COG3536Uncharacterized conserved protein, DUF971 familyFunction unknown [S] 0.22
COG3548Uncharacterized membrane proteinFunction unknown [S] 0.22
COG3768Uncharacterized membrane protein YcjF, UPF0283 familyFunction unknown [S] 0.22
COG3876Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 familyCell wall/membrane/envelope biogenesis [M] 0.22
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.22
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.22
COG4644Transposase and inactivated derivatives, TnpA familyMobilome: prophages, transposons [X] 0.22
COG4804Predicted nuclease of restriction endonuclease-like (RecB) superfamily, DUF1016 familyGeneral function prediction only [R] 0.22
COG5434PolygalacturonaseCarbohydrate transport and metabolism [G] 0.22
COG5654Predicted toxin component of a toxin-antitoxin system, contains RES domainDefense mechanisms [V] 0.22

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.74 %
UnclassifiedrootN/A33.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908004|PBDC3_FUFP16391_g1All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300001213|JGIcombinedJ13530_104288586All Organisms → cellular organisms → Bacteria1540Open in IMG/M
3300001534|A15PFW1_10203130Not Available761Open in IMG/M
3300004091|Ga0062387_101768020Not Available504Open in IMG/M
3300004092|Ga0062389_102109403All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300005447|Ga0066689_10912526All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes543Open in IMG/M
3300005531|Ga0070738_10012485All Organisms → cellular organisms → Bacteria7289Open in IMG/M
3300005531|Ga0070738_10045241All Organisms → cellular organisms → Bacteria2830Open in IMG/M
3300005602|Ga0070762_11047205Not Available561Open in IMG/M
3300005764|Ga0066903_102968499Not Available919Open in IMG/M
3300005830|Ga0074473_10853379All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300005938|Ga0066795_10055311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71171Open in IMG/M
3300005995|Ga0066790_10310766All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300006055|Ga0097691_1001005All Organisms → cellular organisms → Bacteria21968Open in IMG/M
3300006057|Ga0075026_100913639Not Available540Open in IMG/M
3300006059|Ga0075017_100053317All Organisms → cellular organisms → Bacteria2723Open in IMG/M
3300006059|Ga0075017_100232411All Organisms → cellular organisms → Bacteria1343Open in IMG/M
3300006162|Ga0075030_100212187All Organisms → cellular organisms → Bacteria1557Open in IMG/M
3300006162|Ga0075030_100512578All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300006638|Ga0075522_10020419All Organisms → cellular organisms → Bacteria → Proteobacteria4183Open in IMG/M
3300006638|Ga0075522_10029826All Organisms → cellular organisms → Bacteria3325Open in IMG/M
3300006638|Ga0075522_10395931Not Available653Open in IMG/M
3300006642|Ga0075521_10078455All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300006795|Ga0075520_1001663All Organisms → cellular organisms → Bacteria10804Open in IMG/M
3300006795|Ga0075520_1051144All Organisms → cellular organisms → Bacteria1982Open in IMG/M
3300006864|Ga0066797_1010722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA73112Open in IMG/M
3300006893|Ga0073928_10003333All Organisms → cellular organisms → Bacteria25594Open in IMG/M
3300006950|Ga0075524_10296444Not Available709Open in IMG/M
3300009012|Ga0066710_104397916Not Available526Open in IMG/M
3300009012|Ga0066710_104676521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans512Open in IMG/M
3300009029|Ga0066793_10063155Not Available2112Open in IMG/M
3300009029|Ga0066793_10469216Not Available721Open in IMG/M
3300009029|Ga0066793_10722720All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300009032|Ga0105048_10096520All Organisms → cellular organisms → Bacteria3933Open in IMG/M
3300009175|Ga0073936_10074510All Organisms → cellular organisms → Bacteria → Proteobacteria2931Open in IMG/M
3300009175|Ga0073936_10164184All Organisms → cellular organisms → Bacteria → Proteobacteria1641Open in IMG/M
3300009524|Ga0116225_1543252Not Available516Open in IMG/M
3300009547|Ga0116136_1089539All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium808Open in IMG/M
3300009552|Ga0116138_1065114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1029Open in IMG/M
3300009614|Ga0116104_1011570All Organisms → cellular organisms → Bacteria → Acidobacteria2725Open in IMG/M
3300009618|Ga0116127_1095959All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300009629|Ga0116119_1109365All Organisms → cellular organisms → Bacteria → Proteobacteria693Open in IMG/M
3300009630|Ga0116114_1053785All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1129Open in IMG/M
3300009633|Ga0116129_1003560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7435Open in IMG/M
3300009633|Ga0116129_1010191Not Available3696Open in IMG/M
3300009633|Ga0116129_1102326Not Available829Open in IMG/M
3300009633|Ga0116129_1138993All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300009640|Ga0116126_1075408All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300009700|Ga0116217_10880442Not Available550Open in IMG/M
3300009760|Ga0116131_1091540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium920Open in IMG/M
3300009760|Ga0116131_1206814Not Available547Open in IMG/M
3300009762|Ga0116130_1254454All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300009868|Ga0130016_10128846All Organisms → cellular organisms → Bacteria → Proteobacteria2097Open in IMG/M
3300010341|Ga0074045_10022656All Organisms → cellular organisms → Bacteria4881Open in IMG/M
3300010341|Ga0074045_10255928All Organisms → cellular organisms → Bacteria → Acidobacteria1157Open in IMG/M
3300010346|Ga0116239_10618267Not Available701Open in IMG/M
3300010357|Ga0116249_10884713Not Available811Open in IMG/M
3300010366|Ga0126379_10751329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1072Open in IMG/M
3300010366|Ga0126379_11154395Not Available881Open in IMG/M
3300010379|Ga0136449_100028629All Organisms → cellular organisms → Bacteria13625Open in IMG/M
3300010379|Ga0136449_100253934All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3262Open in IMG/M
3300010379|Ga0136449_100319877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2813Open in IMG/M
3300010379|Ga0136449_100516438All Organisms → cellular organisms → Bacteria → Acidobacteria2068Open in IMG/M
3300010379|Ga0136449_100887956All Organisms → cellular organisms → Bacteria1455Open in IMG/M
3300010379|Ga0136449_103006787Not Available658Open in IMG/M
3300010379|Ga0136449_104280487Not Available528Open in IMG/M
3300010379|Ga0136449_104367903Not Available522Open in IMG/M
3300010396|Ga0134126_12169864All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300010398|Ga0126383_11115835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3878Open in IMG/M
3300010429|Ga0116241_10029263All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Hydrogenedentes bacterium JGI 0000077-D075480Open in IMG/M
3300011270|Ga0137391_10676176Not Available860Open in IMG/M
3300011271|Ga0137393_10913285All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300011420|Ga0137314_1111993Not Available671Open in IMG/M
3300012209|Ga0137379_10000075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae78333Open in IMG/M
3300012209|Ga0137379_10000097All Organisms → cellular organisms → Bacteria69845Open in IMG/M
3300012210|Ga0137378_10258983All Organisms → cellular organisms → Bacteria1619Open in IMG/M
3300012353|Ga0137367_10048053All Organisms → cellular organisms → Bacteria3221Open in IMG/M
3300012353|Ga0137367_10186027Not Available1508Open in IMG/M
3300012353|Ga0137367_10536060All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300012532|Ga0137373_11257518Not Available518Open in IMG/M
3300012923|Ga0137359_10234283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41639Open in IMG/M
3300012923|Ga0137359_10657880Not Available915Open in IMG/M
3300012925|Ga0137419_11287320Not Available614Open in IMG/M
(restricted) 3300013130|Ga0172363_10645363All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium667Open in IMG/M
3300014152|Ga0181533_1001114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae35122Open in IMG/M
3300014152|Ga0181533_1013578All Organisms → cellular organisms → Bacteria5861Open in IMG/M
3300014152|Ga0181533_1339931Not Available537Open in IMG/M
3300014153|Ga0181527_1009469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium7311Open in IMG/M
3300014156|Ga0181518_10392633All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300014160|Ga0181517_10001531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE006825503Open in IMG/M
3300014160|Ga0181517_10001729All Organisms → cellular organisms → Bacteria23549Open in IMG/M
3300014160|Ga0181517_10028166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.3716Open in IMG/M
3300014160|Ga0181517_10042787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2842Open in IMG/M
3300014160|Ga0181517_10115707Not Available1543Open in IMG/M
3300014160|Ga0181517_10366483All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300014160|Ga0181517_10497976All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300014161|Ga0181529_10193641Not Available1198Open in IMG/M
3300014167|Ga0181528_10078351All Organisms → cellular organisms → Bacteria → Acidobacteria1808Open in IMG/M
3300014167|Ga0181528_10368270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae781Open in IMG/M
3300014199|Ga0181535_10597288Not Available633Open in IMG/M
3300014489|Ga0182018_10000271All Organisms → cellular organisms → Bacteria68851Open in IMG/M
3300014489|Ga0182018_10119827Not Available1525Open in IMG/M
3300014489|Ga0182018_10453563Not Available682Open in IMG/M
3300014490|Ga0182010_10223746All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300014490|Ga0182010_10714695Not Available564Open in IMG/M
3300014490|Ga0182010_10799817Not Available534Open in IMG/M
3300014491|Ga0182014_10000177All Organisms → cellular organisms → Bacteria77828Open in IMG/M
3300014491|Ga0182014_10000765All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae43517Open in IMG/M
3300014491|Ga0182014_10004449All Organisms → cellular organisms → Bacteria16075Open in IMG/M
3300014491|Ga0182014_10005520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae14012Open in IMG/M
3300014491|Ga0182014_10007509All Organisms → cellular organisms → Bacteria → Proteobacteria11407Open in IMG/M
3300014491|Ga0182014_10040985All Organisms → cellular organisms → Bacteria3354Open in IMG/M
3300014491|Ga0182014_10050384All Organisms → cellular organisms → Bacteria → Proteobacteria2878Open in IMG/M
3300014491|Ga0182014_10104614Not Available1694Open in IMG/M
3300014491|Ga0182014_10125269Not Available1493Open in IMG/M
3300014491|Ga0182014_10159272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1263Open in IMG/M
3300014491|Ga0182014_10256237Not Available916Open in IMG/M
3300014491|Ga0182014_10380340All Organisms → cellular organisms → Bacteria → Proteobacteria708Open in IMG/M
3300014492|Ga0182013_10026753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4966Open in IMG/M
3300014492|Ga0182013_10105330All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1890Open in IMG/M
3300014492|Ga0182013_10227319All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300014493|Ga0182016_10018938All Organisms → cellular organisms → Bacteria6234Open in IMG/M
3300014493|Ga0182016_10036545All Organisms → cellular organisms → Bacteria → Acidobacteria4042Open in IMG/M
3300014493|Ga0182016_10670025Not Available585Open in IMG/M
3300014494|Ga0182017_10269469All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300014494|Ga0182017_10274113Not Available1061Open in IMG/M
3300014494|Ga0182017_10350276All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300014494|Ga0182017_10590975All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300014494|Ga0182017_10608111Not Available665Open in IMG/M
3300014494|Ga0182017_10966690Not Available511Open in IMG/M
3300014496|Ga0182011_10049270All Organisms → cellular organisms → Bacteria2989Open in IMG/M
3300014496|Ga0182011_10559917Not Available731Open in IMG/M
3300014499|Ga0182012_10010216All Organisms → cellular organisms → Bacteria → Acidobacteria9104Open in IMG/M
3300014499|Ga0182012_10287990Not Available1112Open in IMG/M
3300014499|Ga0182012_10373970All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus945Open in IMG/M
3300014501|Ga0182024_10007858All Organisms → cellular organisms → Bacteria22840Open in IMG/M
3300014501|Ga0182024_10014425All Organisms → cellular organisms → Bacteria15274Open in IMG/M
3300014501|Ga0182024_10035285All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. OK0918414Open in IMG/M
3300014501|Ga0182024_10046518All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea6977Open in IMG/M
3300014501|Ga0182024_10663862Not Available1293Open in IMG/M
3300014501|Ga0182024_10833286All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300014501|Ga0182024_11982643All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300014502|Ga0182021_11098785All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300014638|Ga0181536_10300958Not Available746Open in IMG/M
3300014655|Ga0181516_10044617Not Available2247Open in IMG/M
3300014655|Ga0181516_10179653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1073Open in IMG/M
3300014745|Ga0157377_10766997Not Available707Open in IMG/M
3300014838|Ga0182030_10406321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1415Open in IMG/M
3300014838|Ga0182030_10652139Not Available1000Open in IMG/M
3300014838|Ga0182030_10764694All Organisms → cellular organisms → Bacteria → Acidobacteria891Open in IMG/M
3300014838|Ga0182030_10872555All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300014838|Ga0182030_11001115Not Available736Open in IMG/M
3300014839|Ga0182027_10008472All Organisms → cellular organisms → Bacteria → Proteobacteria14959Open in IMG/M
3300014839|Ga0182027_10100480All Organisms → cellular organisms → Bacteria → Acidobacteria3486Open in IMG/M
3300014839|Ga0182027_10155364All Organisms → cellular organisms → Bacteria2691Open in IMG/M
3300014839|Ga0182027_10186235All Organisms → cellular organisms → Bacteria2418Open in IMG/M
3300014839|Ga0182027_10214694All Organisms → cellular organisms → Bacteria2222Open in IMG/M
3300014839|Ga0182027_10232571All Organisms → cellular organisms → Bacteria2118Open in IMG/M
3300014839|Ga0182027_10338095Not Available1691Open in IMG/M
3300014839|Ga0182027_10340824All Organisms → cellular organisms → Bacteria → Proteobacteria1683Open in IMG/M
3300014839|Ga0182027_10358755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61632Open in IMG/M
3300014839|Ga0182027_10435225All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium1448Open in IMG/M
3300014839|Ga0182027_10602498Not Available1180Open in IMG/M
3300014839|Ga0182027_10609335Not Available1172Open in IMG/M
3300014839|Ga0182027_10659660All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1114Open in IMG/M
3300014839|Ga0182027_10782118Not Available1001Open in IMG/M
3300014839|Ga0182027_11184895All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300014839|Ga0182027_11680166Not Available618Open in IMG/M
3300014839|Ga0182027_11817645Not Available589Open in IMG/M
3300014839|Ga0182027_12103098All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300014839|Ga0182027_12158487Not Available530Open in IMG/M
3300014873|Ga0180066_1127328Not Available525Open in IMG/M
3300015082|Ga0167662_1034483Not Available647Open in IMG/M
3300015252|Ga0180075_1020515Not Available933Open in IMG/M
3300015360|Ga0163144_10045572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus7921Open in IMG/M
3300016270|Ga0182036_11450645Not Available575Open in IMG/M
3300016357|Ga0182032_10382645All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300017925|Ga0187856_1004891All Organisms → cellular organisms → Bacteria8745Open in IMG/M
3300017935|Ga0187848_10275556All Organisms → cellular organisms → Bacteria → Proteobacteria706Open in IMG/M
3300017941|Ga0187850_10282052Not Available740Open in IMG/M
3300017941|Ga0187850_10360594Not Available637Open in IMG/M
3300017943|Ga0187819_10486047All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300017946|Ga0187879_10106726All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300017975|Ga0187782_10559002All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300017988|Ga0181520_10000047All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae219957Open in IMG/M
3300017988|Ga0181520_10004296All Organisms → cellular organisms → Bacteria23999Open in IMG/M
3300017988|Ga0181520_10004422All Organisms → cellular organisms → Bacteria23549Open in IMG/M
3300017988|Ga0181520_10004775All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae22297Open in IMG/M
3300017988|Ga0181520_10023506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 836862Open in IMG/M
3300017988|Ga0181520_10046297All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4212Open in IMG/M
3300017988|Ga0181520_10169982All Organisms → cellular organisms → Bacteria1747Open in IMG/M
3300017988|Ga0181520_10294433All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300017996|Ga0187891_1119616All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium970Open in IMG/M
3300017996|Ga0187891_1281544All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300018003|Ga0187876_1222257All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300018004|Ga0187865_1002633All Organisms → cellular organisms → Bacteria16562Open in IMG/M
3300018004|Ga0187865_1006452All Organisms → cellular organisms → Bacteria7593Open in IMG/M
3300018009|Ga0187884_10055884All Organisms → cellular organisms → Bacteria → Acidobacteria1824Open in IMG/M
3300018009|Ga0187884_10114173All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1163Open in IMG/M
3300018015|Ga0187866_1083763All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1351Open in IMG/M
3300018017|Ga0187872_10049842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2245Open in IMG/M
3300018023|Ga0187889_10014621All Organisms → cellular organisms → Bacteria4984Open in IMG/M
3300018034|Ga0187863_10846290All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300018035|Ga0187875_10041019All Organisms → cellular organisms → Bacteria2733Open in IMG/M
3300018035|Ga0187875_10398777Not Available735Open in IMG/M
3300018035|Ga0187875_10582954Not Available590Open in IMG/M
3300018038|Ga0187855_10361805Not Available847Open in IMG/M
3300018043|Ga0187887_10208341All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300018053|Ga0184626_10214056All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300018059|Ga0184615_10103890All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.1600Open in IMG/M
3300019487|Ga0187893_10165385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1767Open in IMG/M
3300019788|Ga0182028_1351043Not Available2029Open in IMG/M
3300019888|Ga0193751_1148417All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae844Open in IMG/M
3300020021|Ga0193726_1247038All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300020083|Ga0194111_10331615Not Available1033Open in IMG/M
3300020192|Ga0163147_10401792All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300020201|Ga0163154_10481357Not Available541Open in IMG/M
3300020203|Ga0163148_10493732Not Available563Open in IMG/M
3300020203|Ga0163148_10514139Not Available545Open in IMG/M
3300020582|Ga0210395_10599821All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium827Open in IMG/M
3300021168|Ga0210406_10308783All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300021407|Ga0210383_11407295Not Available580Open in IMG/M
3300021474|Ga0210390_10522222All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300021477|Ga0210398_11206894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300021559|Ga0210409_11588709Not Available530Open in IMG/M
3300021560|Ga0126371_12637315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales609Open in IMG/M
3300022222|Ga0226658_10419709All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus598Open in IMG/M
3300022524|Ga0224534_1018839Not Available1869Open in IMG/M
3300022524|Ga0224534_1032971All Organisms → cellular organisms → Bacteria → Acidobacteria1218Open in IMG/M
3300022526|Ga0224533_1038402Not Available807Open in IMG/M
3300022553|Ga0212124_10407325All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium714Open in IMG/M
3300022849|Ga0224531_1000385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae23013Open in IMG/M
3300022861|Ga0224528_1003097All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8665Open in IMG/M
3300022861|Ga0224528_1006949All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4180Open in IMG/M
3300022861|Ga0224528_1018451Not Available1715Open in IMG/M
3300022861|Ga0224528_1029973All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300022872|Ga0224526_1073627Not Available636Open in IMG/M
3300022872|Ga0224526_1088316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300023075|Ga0224520_1084841Not Available709Open in IMG/M
3300023088|Ga0224555_1003450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia16099Open in IMG/M
3300023090|Ga0224558_1062990All Organisms → cellular organisms → Bacteria1439Open in IMG/M
3300023090|Ga0224558_1083908All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae1160Open in IMG/M
3300023090|Ga0224558_1146798Not Available761Open in IMG/M
3300023090|Ga0224558_1174352All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300023101|Ga0224557_1016682All Organisms → cellular organisms → Bacteria4074Open in IMG/M
3300023247|Ga0224529_1005071Not Available4494Open in IMG/M
3300023247|Ga0224529_1006850All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3433Open in IMG/M
3300023247|Ga0224529_1042585All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium830Open in IMG/M
3300023250|Ga0224544_1012193Not Available1164Open in IMG/M
3300023258|Ga0224535_1127810Not Available536Open in IMG/M
3300024233|Ga0224521_1053228Not Available900Open in IMG/M
3300024233|Ga0224521_1124422Not Available549Open in IMG/M
3300025404|Ga0208936_1014416Not Available992Open in IMG/M
3300025409|Ga0208321_1024757All Organisms → cellular organisms → Bacteria → Acidobacteria1053Open in IMG/M
3300025409|Ga0208321_1043642Not Available697Open in IMG/M
3300025444|Ga0208189_1030243All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300025448|Ga0208037_1021878All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin1411485Open in IMG/M
3300025463|Ga0208193_1003257All Organisms → cellular organisms → Bacteria6214Open in IMG/M
3300025506|Ga0208937_1014313All Organisms → cellular organisms → Bacteria → Acidobacteria2032Open in IMG/M
3300025506|Ga0208937_1064930All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300025576|Ga0208820_1034878All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300025650|Ga0209385_1018591All Organisms → cellular organisms → Bacteria → Acidobacteria2823Open in IMG/M
3300025650|Ga0209385_1117914Not Available833Open in IMG/M
3300025650|Ga0209385_1144856Not Available712Open in IMG/M
3300025679|Ga0207933_1007716All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5478Open in IMG/M
3300025706|Ga0209507_1155283All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes616Open in IMG/M
3300025829|Ga0209484_10149487Not Available565Open in IMG/M
3300025862|Ga0209483_1051293All Organisms → cellular organisms → Bacteria1943Open in IMG/M
3300025878|Ga0209584_10272836Not Available649Open in IMG/M
3300025888|Ga0209540_10070196All Organisms → cellular organisms → Bacteria2157Open in IMG/M
3300025903|Ga0207680_10712315All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300025910|Ga0207684_11102939Not Available660Open in IMG/M
3300025944|Ga0207661_10000334All Organisms → cellular organisms → Bacteria30010Open in IMG/M
3300026223|Ga0209840_1101120Not Available622Open in IMG/M
3300026451|Ga0247845_1061576All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300026467|Ga0257154_1058464All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300026489|Ga0257160_1006833All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1514Open in IMG/M
3300026502|Ga0255350_1003383All Organisms → cellular organisms → Bacteria → Acidobacteria5303Open in IMG/M
3300026502|Ga0255350_1091875All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60667Open in IMG/M
3300026515|Ga0257158_1122524All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300026538|Ga0209056_10486149Not Available658Open in IMG/M
3300026551|Ga0209648_10260100Not Available1278Open in IMG/M
3300026551|Ga0209648_10296946Not Available1159Open in IMG/M
3300027641|Ga0208827_1033456All Organisms → cellular organisms → Bacteria → Acidobacteria1820Open in IMG/M
3300027641|Ga0208827_1058487Not Available1260Open in IMG/M
3300027706|Ga0209581_1000184All Organisms → cellular organisms → Bacteria195345Open in IMG/M
(restricted) 3300027799|Ga0233416_10339036Not Available518Open in IMG/M
3300027812|Ga0209656_10447068Not Available572Open in IMG/M
3300027840|Ga0209683_10453160Not Available588Open in IMG/M
3300027842|Ga0209580_10523692Not Available590Open in IMG/M
3300027846|Ga0209180_10405493Not Available772Open in IMG/M
3300027853|Ga0209274_10345588All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300027854|Ga0209517_10156829All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinales incertae sedis → GOM Arc I cluster → Candidatus Argoarchaeum → Candidatus Argoarchaeum ethanivorans1450Open in IMG/M
3300027854|Ga0209517_10160169Not Available1430Open in IMG/M
3300027854|Ga0209517_10566723Not Available607Open in IMG/M
3300027875|Ga0209283_10136942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → Micavibrio → Micavibrio aeruginosavorus1620Open in IMG/M
3300027875|Ga0209283_10909044Not Available532Open in IMG/M
3300027878|Ga0209181_10987206Not Available546Open in IMG/M
3300027882|Ga0209590_10114823All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1629Open in IMG/M
3300027885|Ga0209450_10053460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium2508Open in IMG/M
3300027896|Ga0209777_10051655All Organisms → cellular organisms → Bacteria3716Open in IMG/M
3300027898|Ga0209067_10688220Not Available592Open in IMG/M
3300027984|Ga0209629_11004600Not Available527Open in IMG/M
(restricted) 3300027995|Ga0233418_10101420All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium869Open in IMG/M
3300028028|Ga0265292_1005563All Organisms → cellular organisms → Bacteria → Proteobacteria6636Open in IMG/M
3300028032|Ga0265296_1024567All Organisms → cellular organisms → Bacteria3206Open in IMG/M
(restricted) 3300028043|Ga0233417_10001636All Organisms → cellular organisms → Bacteria → Acidobacteria7400Open in IMG/M
(restricted) 3300028043|Ga0233417_10398389All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300028068|Ga0255355_1012728Not Available1938Open in IMG/M
3300028070|Ga0255353_1005817Not Available4630Open in IMG/M
3300028552|Ga0302149_1005284All Organisms → cellular organisms → Bacteria3575Open in IMG/M
3300028560|Ga0302144_10126721All Organisms → cellular organisms → Bacteria824Open in IMG/M
(restricted) 3300028593|Ga0255347_1343845Not Available604Open in IMG/M
3300028649|Ga0302162_10086766All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300028653|Ga0265323_10063256All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata1282Open in IMG/M
3300028673|Ga0257175_1110143All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group544Open in IMG/M
3300028745|Ga0302267_10000127All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae96098Open in IMG/M
3300028745|Ga0302267_10000727All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae43922Open in IMG/M
3300028745|Ga0302267_10002358All Organisms → cellular organisms → Bacteria22959Open in IMG/M
3300028765|Ga0302198_10001827All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae22947Open in IMG/M
3300028765|Ga0302198_10099044All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales1596Open in IMG/M
3300028785|Ga0302201_10021726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3613Open in IMG/M
3300028785|Ga0302201_10109035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1236Open in IMG/M
3300028785|Ga0302201_10119704Not Available1163Open in IMG/M
3300028800|Ga0265338_10379612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41011Open in IMG/M
3300028800|Ga0265338_10429527Not Available938Open in IMG/M
3300028813|Ga0302157_10125074All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1566Open in IMG/M
3300028860|Ga0302199_1007563All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00684631Open in IMG/M
3300028882|Ga0302154_10408247All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae654Open in IMG/M
3300029907|Ga0311329_10836529Not Available584Open in IMG/M
3300029911|Ga0311361_10023841All Organisms → cellular organisms → Bacteria11067Open in IMG/M
3300029911|Ga0311361_10120138All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3607Open in IMG/M
3300029911|Ga0311361_10351198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1599Open in IMG/M
3300029913|Ga0311362_10003011All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae34395Open in IMG/M
3300029913|Ga0311362_10088518All Organisms → cellular organisms → Bacteria4214Open in IMG/M
3300029914|Ga0311359_10756716Not Available687Open in IMG/M
3300029915|Ga0311358_10015728All Organisms → cellular organisms → Bacteria → Acidobacteria10317Open in IMG/M
3300029922|Ga0311363_10036074All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8108Open in IMG/M
3300029952|Ga0311346_11318246All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales553Open in IMG/M
3300029954|Ga0311331_10842814All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300029982|Ga0302277_1112294All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300029999|Ga0311339_10542154Not Available1172Open in IMG/M
3300030020|Ga0311344_10362501All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300030043|Ga0302306_10355574Not Available561Open in IMG/M
3300030056|Ga0302181_10285352Not Available737Open in IMG/M
3300030057|Ga0302176_10085290All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300030508|Ga0302185_10120522Not Available929Open in IMG/M
3300030580|Ga0311355_10508673All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300030618|Ga0311354_10884865Not Available834Open in IMG/M
3300030659|Ga0316363_10020951All Organisms → cellular organisms → Bacteria → Acidobacteria3539Open in IMG/M
3300031057|Ga0170834_100519761Not Available956Open in IMG/M
3300031122|Ga0170822_11608926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300031128|Ga0170823_15645123Not Available680Open in IMG/M
3300031231|Ga0170824_116938620Not Available516Open in IMG/M
3300031232|Ga0302323_100614212Not Available1179Open in IMG/M
3300031233|Ga0302307_10586414All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium562Open in IMG/M
3300031234|Ga0302325_10007556All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae24094Open in IMG/M
3300031234|Ga0302325_10321678All Organisms → cellular organisms → Bacteria2487Open in IMG/M
3300031234|Ga0302325_10994218All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300031236|Ga0302324_100025233All Organisms → cellular organisms → Bacteria11415Open in IMG/M
3300031236|Ga0302324_100400836All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS4662046Open in IMG/M
3300031236|Ga0302324_101835963Not Available769Open in IMG/M
3300031259|Ga0302187_10030598All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3596Open in IMG/M
3300031261|Ga0302140_10121089All Organisms → cellular organisms → Bacteria2561Open in IMG/M
3300031261|Ga0302140_11036030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria561Open in IMG/M
3300031344|Ga0265316_10344236All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300031524|Ga0302320_10026095All Organisms → cellular organisms → Bacteria11328Open in IMG/M
3300031524|Ga0302320_10341428All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica1943Open in IMG/M
3300031524|Ga0302320_10880142Not Available974Open in IMG/M
3300031524|Ga0302320_10970278All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus907Open in IMG/M
3300031525|Ga0302326_10334959Not Available2391Open in IMG/M
3300031525|Ga0302326_11621228All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus859Open in IMG/M
3300031525|Ga0302326_12465759All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae654Open in IMG/M
3300031525|Ga0302326_13084611All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031525|Ga0302326_13398522Not Available532Open in IMG/M
3300031576|Ga0247727_10031012All Organisms → cellular organisms → Bacteria7383Open in IMG/M
3300031595|Ga0265313_10074249All Organisms → cellular organisms → Bacteria → Acidobacteria1560Open in IMG/M
3300031670|Ga0307374_10033728All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5835Open in IMG/M
3300031670|Ga0307374_10070816All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3316Open in IMG/M
3300031670|Ga0307374_10159749All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300031672|Ga0307373_10033980All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5836Open in IMG/M
3300031707|Ga0315291_10106654All Organisms → cellular organisms → Bacteria3010Open in IMG/M
3300031707|Ga0315291_10454491All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300031707|Ga0315291_10990958Not Available708Open in IMG/M
3300031708|Ga0310686_100976466All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300031708|Ga0310686_118779297Not Available985Open in IMG/M
3300031708|Ga0310686_119608840Not Available584Open in IMG/M
3300031746|Ga0315293_10838043Not Available670Open in IMG/M
3300031746|Ga0315293_10884119Not Available646Open in IMG/M
3300031772|Ga0315288_10165103All Organisms → cellular organisms → Bacteria2446Open in IMG/M
3300031788|Ga0302319_10229654All Organisms → cellular organisms → Bacteria2288Open in IMG/M
3300031788|Ga0302319_10389634All Organisms → cellular organisms → Bacteria1562Open in IMG/M
3300031788|Ga0302319_11218515All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300031801|Ga0310121_10445908Not Available726Open in IMG/M
3300031801|Ga0310121_10567357Not Available619Open in IMG/M
3300031802|Ga0310123_10010569All Organisms → cellular organisms → Bacteria6658Open in IMG/M
3300031802|Ga0310123_10046507All Organisms → cellular organisms → Bacteria3064Open in IMG/M
3300031802|Ga0310123_10081754All Organisms → cellular organisms → Bacteria2255Open in IMG/M
3300031802|Ga0310123_10130910Not Available1727Open in IMG/M
3300031803|Ga0310120_10049843All Organisms → cellular organisms → Bacteria2471Open in IMG/M
3300031803|Ga0310120_10064578All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.2137Open in IMG/M
3300031803|Ga0310120_10096151All Organisms → cellular organisms → Bacteria → Acidobacteria1699Open in IMG/M
3300031813|Ga0316217_10021318All Organisms → cellular organisms → Bacteria4508Open in IMG/M
3300031862|Ga0315280_10012836All Organisms → cellular organisms → Bacteria10050Open in IMG/M
(restricted) 3300031877|Ga0315314_1091581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1301Open in IMG/M
3300031885|Ga0315285_10124029All Organisms → cellular organisms → Bacteria2199Open in IMG/M
3300031885|Ga0315285_10345344All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300031902|Ga0302322_103112402All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus570Open in IMG/M
3300032046|Ga0315289_10004799All Organisms → cellular organisms → Bacteria20124Open in IMG/M
3300032046|Ga0315289_10005532All Organisms → cellular organisms → Bacteria → Acidobacteria18669Open in IMG/M
3300032046|Ga0315289_10119073All Organisms → cellular organisms → Bacteria3052Open in IMG/M
3300032046|Ga0315289_10236768All Organisms → cellular organisms → Bacteria1951Open in IMG/M
3300032053|Ga0315284_10212269All Organisms → cellular organisms → Bacteria2495Open in IMG/M
3300032059|Ga0318533_10524284Not Available869Open in IMG/M
3300032070|Ga0315279_10023341All Organisms → cellular organisms → Bacteria6503Open in IMG/M
3300032070|Ga0315279_10298419All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus1169Open in IMG/M
3300032118|Ga0315277_10107603All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aerophobetes → unclassified Aerophobetes → Candidatus Aerophobetes bacterium Ae_b3b3136Open in IMG/M
3300032156|Ga0315295_11646679Not Available614Open in IMG/M
3300032160|Ga0311301_10219957All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3205Open in IMG/M
3300032160|Ga0311301_10440641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1968Open in IMG/M
3300032160|Ga0311301_10992272All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71112Open in IMG/M
3300032160|Ga0311301_11861498All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300032261|Ga0306920_102027528Not Available805Open in IMG/M
3300032561|Ga0316222_1006965All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8968Open in IMG/M
3300032782|Ga0335082_10521673Not Available1050Open in IMG/M
3300032783|Ga0335079_10984869Not Available861Open in IMG/M
3300032783|Ga0335079_11890057Not Available578Open in IMG/M
3300032783|Ga0335079_12028092Not Available553Open in IMG/M
3300032805|Ga0335078_12420716All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300032829|Ga0335070_12019373Not Available519Open in IMG/M
3300032893|Ga0335069_11908577Not Available628Open in IMG/M
3300032893|Ga0335069_12227534Not Available573Open in IMG/M
3300032895|Ga0335074_10788403All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300033233|Ga0334722_10113471All Organisms → cellular organisms → Bacteria → Acidobacteria2049Open in IMG/M
3300033402|Ga0326728_10000418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae166564Open in IMG/M
3300033402|Ga0326728_10032370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8708Open in IMG/M
3300033402|Ga0326728_10162202All Organisms → cellular organisms → Bacteria2380Open in IMG/M
3300033405|Ga0326727_10999133Not Available610Open in IMG/M
3300033485|Ga0316626_11913989Not Available537Open in IMG/M
3300033513|Ga0316628_103949704All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.530Open in IMG/M
3300033822|Ga0334828_011919All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae2967Open in IMG/M
3300033822|Ga0334828_042908All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans1278Open in IMG/M
3300033887|Ga0334790_015320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae3693Open in IMG/M
3300033887|Ga0334790_056154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli1439Open in IMG/M
3300033887|Ga0334790_130528Not Available776Open in IMG/M
3300033983|Ga0371488_0491814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → Acidipila rosea556Open in IMG/M
3300034178|Ga0364934_0024368All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2200Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog8.04%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil7.59%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen7.14%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.03%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog6.03%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.58%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.13%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.69%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.46%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.02%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.57%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.46%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.46%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.01%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.56%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat1.34%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.12%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.12%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.12%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.89%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.89%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.89%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.67%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.67%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.67%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.45%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.45%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.45%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.45%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.45%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.22%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.22%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.22%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.22%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.22%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.22%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.22%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.22%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.22%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.22%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.22%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.22%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.22%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.22%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.22%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.22%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.22%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.22%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.22%
Landfill LeachateEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate0.22%
Poplar Biomass BioreactorEngineered → Solid Waste → Wood → Composting → Bioreactor → Poplar Biomass Bioreactor0.22%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.22%
WastewaterEngineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater0.22%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908004Poplar biomass bioreactor microbial communities from Brookhaven National Lab, NY - total biomass decay communityEngineeredOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001534Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009032Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05EnvironmentalOpen in IMG/M
3300009175Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009614Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010346AD_USMOcaEngineeredOpen in IMG/M
3300010357AD_USSTcaEngineeredOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010429AD_USRAcaEngineeredOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300015082Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015252Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10DEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020192Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1EnvironmentalOpen in IMG/M
3300020201Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP9.P1EnvironmentalOpen in IMG/M
3300020203Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022222Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2)EnvironmentalOpen in IMG/M
3300022524Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24EnvironmentalOpen in IMG/M
3300022526Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 10-14EnvironmentalOpen in IMG/M
3300022553Powell_combined assemblyEnvironmentalOpen in IMG/M
3300022849Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T100EnvironmentalOpen in IMG/M
3300022861Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T25EnvironmentalOpen in IMG/M
3300022872Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25EnvironmentalOpen in IMG/M
3300023075Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300023247Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T50EnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300023258Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34EnvironmentalOpen in IMG/M
3300024233Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0EnvironmentalOpen in IMG/M
3300025404Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025409Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025463Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025650Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes)EnvironmentalOpen in IMG/M
3300025679Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025706Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025829Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026223Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)EnvironmentalOpen in IMG/M
3300026451Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T-25EnvironmentalOpen in IMG/M
3300026467Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-AEnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026502Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1EnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027878Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027984Cubitermes ugandensis P5 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027995 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MGEnvironmentalOpen in IMG/M
3300028028Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 296AEngineeredOpen in IMG/M
3300028032Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028068Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T75EnvironmentalOpen in IMG/M
3300028070Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T25EnvironmentalOpen in IMG/M
3300028552Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028593 (restricted)Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24EngineeredOpen in IMG/M
3300028649Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2EnvironmentalOpen in IMG/M
3300028653Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaGHost-AssociatedOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028765Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030508Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_2EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031672Soil microbial communities from Risofladan, Vaasa, Finland - OX-2EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031801Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986EnvironmentalOpen in IMG/M
3300031802Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057EnvironmentalOpen in IMG/M
3300031803Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983EnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031877 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032070Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032561Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
PBDC3_073780102124908004Poplar Biomass BioreactorSTLEDPTTLFEKTPILQALQASGSNNNLLDPGKQLILFDF
JGIcombinedJ13530_10428858653300001213WetlandSVTLFEKSPILQALQTFGSQDESSASGNQLILFDF*
A15PFW1_1020313023300001534PermafrostLTLFEKTPILQALQPSDSEPDLQDPGSQLILFDF*
Ga0062387_10176802013300004091Bog Forest SoilILQILSVTLFEKTPILRALQACDSDYDLFDIGNQLILFNF*
Ga0062389_10210940323300004092Bog Forest SoilSVTLFEKTPILQALYPSDSQADLFDDPNQLNLFTLPDSSVGI*
Ga0066689_1091252613300005447SoilILQILSVTLFEKMPILQALQSPDSRNDLLDQGNQLILFDF*
Ga0070738_10012485123300005531Surface SoilVTLFEKTPIFRALQEPCSQEHLGDLGNQLILFDF*
Ga0070738_1004524143300005531Surface SoilVTLFEKTPILRALQASDSEIELLDSGNQLILFDF*
Ga0070762_1104720533300005602SoilSVTLFEKTPILQALCPSDSQNDPFDDHNQLSLFTL*
Ga0066903_10296849913300005764Tropical Forest SoilVTLFEKTPVLRALQPPVSTNELLDFPNQLNLFGL*
Ga0074473_1085337923300005830Sediment (Intertidal)VTLFEKTPILRALQASNSKTDLLDSGNQLILFDF*
Ga0066795_1005531113300005938SoilVTLFEKTPILRALQDDNSQSDLLDYSNQLILFGL*
Ga0066790_1031076623300005995SoilLSLTLFEKTPLLQALQPFDSQEYLVDSGNQLNLFGL*
Ga0097691_1001005223300006055Arctic Peat SoilLSVTLFEKTPILRALQNSNSQSDLLDYSNQLILFNL*
Ga0075026_10091363913300006057WatershedsLTLFEKTPILQALQSSDSQEELLDPGNQLILFDS*
Ga0075017_10005331713300006059WatershedsILSVTLFEKTPILRALQASDFENDPLDAGNQLVLFDF*
Ga0075017_10023241123300006059WatershedsVTLFEKTPILQALQASDSQADLLDPGNQLILFDF*
Ga0075030_10021218743300006162WatershedsITLFEKVPILQALQASDSQPDLPDPCNQLNLFDF*
Ga0075030_10051257813300006162WatershedsVTLFEKTPILQALQPPDSQDDLLASANQLNLFEL*
Ga0075522_1002041913300006638Arctic Peat SoilLTLFEKTPILRALQTSDYDNDLGDIGNQLILFDL*
Ga0075522_1002982633300006638Arctic Peat SoilVLLDPFEEKTPILQALQPTDSEELLPDFSNQLNLFNL*
Ga0075522_1039593123300006638Arctic Peat SoilLSLFEKMPILQALQPPNSESDLPDPGNQLILFSL*
Ga0075521_1007845523300006642Arctic Peat SoilVTLFEKTPILRALQNSNSQSDLLDYSNQLILFNL*
Ga0075520_100166313300006795Arctic Peat SoilSVTLFEKTPILRALQNSNSQSDLLDYSNQLILFNL*
Ga0075520_105114413300006795Arctic Peat SoilSLTLFEKAPILWALQAPDFNNDLVDSGNQFNLFDF*
Ga0066797_101072243300006864SoilSVTLFEKTPILRALQDDNSQSDLLDYSNQLILFGL*
Ga0073928_1000333313300006893Iron-Sulfur Acid SpringSVTLFEKTPILQALQTFDVEENLLQDANQLILFNL*
Ga0075524_1029644413300006950Arctic Peat SoilTLGCGPLFEKTPVLQALQSFDPHNDLLYASNQLILFDF*
Ga0066710_10439791623300009012Grasslands SoilIFSVTLFKNTPILHALHAPDSGTDLLDPGNQLILSDF
Ga0066710_10467652113300009012Grasslands SoilQILQILSLTLFEKTPILQALQSPDSQDDLLVSANQLNLFDL
Ga0066793_1006315513300009029Prmafrost SoilSLTLFEKTPILQALQASDSQEELLDPGNQLILFDF*
Ga0066793_1046921613300009029Prmafrost SoilSITLFEKTPILRALQNSNSQSDLLDYSNQLILFNL*
Ga0066793_1072272023300009029Prmafrost SoilLSTTLFEKTPILRALQNSIAQSFLLDYSNHLILFNL*
Ga0105048_1009652063300009032FreshwaterSVTLFEKTPILQALQMPDSQNNLLDSGNQLNLWDF*
Ga0073936_1007451013300009175Freshwater Lake HypolimnionLTLFEKTPILQALQTSGCYKDSCDIGNQLILFDL*
Ga0073936_1016418413300009175Freshwater Lake HypolimnionSLTLFEKTPILQALQTSGCYKDSCDIGNQLILFDL*
Ga0116225_154325223300009524Peatlands SoilSLTLFEKTPILQALQAPDSREESLDPGNQLILFEF*
Ga0116136_108953923300009547PeatlandSVTLFEKTPILQALQPPDSQADLLISANQLILFPL*
Ga0116138_106511433300009552PeatlandSVTLFEKTPVLRALQATDSENDLVDSGNQLILFDF*
Ga0116104_101157053300009614PeatlandQILSVTLFEKTPVLRALQATDSENDLVDSGNQLILFDF*
Ga0116127_109595913300009618PeatlandSVTLFEKTPILRALQPSDSDSDLFDIGNQLILFSL*
Ga0116119_110936523300009629PeatlandSVTLFEKTPILRALQASDFENDLGDPGNQLILFDF*
Ga0116114_105378513300009630PeatlandSVTLFEKTPILRTLQRDGFQEELSYPPNQLILFDL*
Ga0116129_1003560103300009633PeatlandSLTLFEKTPILQALQASDSQEELIDPGNQLILFDF*
Ga0116129_101019113300009633PeatlandVTLFEKTPILQALQPPDSQEELFSSANQLILFDL*
Ga0116129_110232623300009633PeatlandLSVTLFEKTPILQALQPPDSQEKLFSSANQLILFDL*
Ga0116129_113899313300009633PeatlandLTLFEKTPILQALQASDSQEELIDPGNQLILFDF*
Ga0116126_107540833300009640PeatlandSVTLFEKTPILQALQAPNSDSDLFDIGNQLILFDF*
Ga0116217_1088044223300009700Peatlands SoilSVMLFEKTPILQALQPPDSQNDLLGSANQMILFDL*
Ga0116131_109154033300009760PeatlandSVTLFEKTPIPRALEASDSQDDPYENSNQLILFDL*
Ga0116131_120681423300009760PeatlandVTLFEKTPILRALQPSDSDSDLFDIGNQLILFSL*
Ga0116130_125445423300009762PeatlandVTLFEKTPILQALQPPDSQDNLSHSANQLNLFDL*
Ga0130016_1012884613300009868WastewaterLSVTLFEKTPLLRALQASDFEKDLVDPGNQLILFDF*
Ga0074045_1002265663300010341Bog Forest SoilSVSLFEKTPILRALEAYTSQDDLAENSNQLILFDL*
Ga0074045_1025592813300010341Bog Forest SoilSVSLFEKTPILRDLEAYTSQDDLAENSNQLILFDL*
Ga0116239_1061826723300010346Anaerobic Digestor SludgeSVTLFEKVPISRAFQASNSQGDLPCPDNQLILFDF*
Ga0116249_1088471323300010357Anaerobic Digestor SludgeFSVTLFEKVPISRAFQASNSQGDLPCPDNQLILFDF*
Ga0126379_1075132913300010366Tropical Forest SoilQILSLTLFEKTPISRKLQASDSEIDLIDLDDQLILFDL*
Ga0126379_1115439513300010366Tropical Forest SoilSLMLFEKVPILQALQPSDSQNESSEDSNQLILFDF*
Ga0136449_100028629113300010379Peatlands SoilSVTLFEKTPILQALQASTSQDDLMVSGNQLILFDL*
Ga0136449_10025393413300010379Peatlands SoilSVTLFEKTPILQALQAPNSDSDLFDISNQLILFDF*
Ga0136449_10031987713300010379Peatlands SoilSLTLFERTPILQVLQTSDSEDDSGDFANQLILFDL*
Ga0136449_10051643843300010379Peatlands SoilSVNLFEKTPILRALQASYSENDLLDTDNQLILFDF*
Ga0136449_10088795613300010379Peatlands SoilQILSVTLFEKTPILQALQAPNSDNDLFDISNQLILFDF*
Ga0136449_10300678733300010379Peatlands SoilSVMLFEKTPILQALQPSDYQDDLLTSTDQLILFDL*
Ga0136449_10428048723300010379Peatlands SoilYQILQILSVTLFEKTPILRALQVSNSECNFVGIDNQLILFNI*
Ga0136449_10436790323300010379Peatlands SoilSVTLFEKTPILQALQASTSQDDLLVSGNQLILFDL*
Ga0134126_1216986423300010396Terrestrial SoilLSLFEKVPILQALQPSDSQSDLLDPSNQLILFDL*
Ga0126383_1111583523300010398Tropical Forest SoilVTLFEKTPILRALQPPVSTNELLDFPNQLNLFGL*
Ga0116241_1002926353300010429Anaerobic Digestor SludgeLSVTLFEKTPILQVLSQHNGKDLEDEGPNQLELFD*
Ga0137391_1067617643300011270Vadose Zone SoilSITLFEKVPILQALQASDSQSDLLNPGNQLNLFDS*
Ga0137393_1091328523300011271Vadose Zone SoilILQILSVTLFEKTPILQAFQAFDSRGDLVDCGSQLNLFDF*
Ga0137314_111199313300011420SoilSVTLFEKTLVLQALQPIDSQDPLADSDNQLNLFDL*
Ga0137379_10000075763300012209Vadose Zone SoilLTLFEKTPILQALQASDACTDLHDPSNQLILFDF*
Ga0137379_1000009713300012209Vadose Zone SoilSLTLFEKTPILQALQASDACTDLHDPSNQLILFDF*
Ga0137378_1025898333300012210Vadose Zone SoilSVTLFEKTPILQAFQAFDSQDNLVDCGNQLNLFDF*
Ga0137367_1004805343300012353Vadose Zone SoilSVTLFEKTPILQALQACDSDSNLVDIGNQLILFNF*
Ga0137367_1018602733300012353Vadose Zone SoilVTLFEKTPILRALQACDSDTNLVDIGNQLILFNF*
Ga0137367_1053606013300012353Vadose Zone SoilSVTLFEKTPILRALQACDSDTNLVDIGNQLILFNF*
Ga0137373_1125751813300012532Vadose Zone SoilILSVTLFEKTPILQALQASDSQEESSDPGNQLILFDF*
Ga0137359_1023428313300012923Vadose Zone SoilSLTLFEKTPILQALQASDSEEELLDPGNQLILFDF*
Ga0137359_1065788013300012923Vadose Zone SoilSVTLFEKTPILQAFQDIDSQSNLLMNANQLILFDF*
Ga0137419_1128732023300012925Vadose Zone SoilILQILSLTLFEKTPILQALQASDSQGESFDHGNQLILFEF*
(restricted) Ga0172363_1064536313300013130SedimentSVTLFEKTPILQALQASDSDSNLVDVGNQLILFDF*
Ga0181533_1001114313300014152BogSVTLFEKTPILQALQIENSQNDLYDSCNQLNLFDF*
Ga0181533_101357873300014152BogSITLFEKVPILQALQASDSQPDLLDPGNQLNLFDF*
Ga0181533_133993113300014152BogSLTLFEKTPILRALQASDFENEIADSGNQLSLFDL*
Ga0181527_100946913300014153BogITLFEKVPILQALQASDSQPDLLDPGNQLNLFDF*
Ga0181518_1039263313300014156BogSVTLFEKTPILRALQASDFANDSVDSGNQLILFDL*
Ga0181517_1000153113300014160BogSITLFEKTPILQALQPSNSDSNLYDSDNQLILFDF*
Ga0181517_1000172913300014160BogSVTLFEKTPILQVLQPGDFHFDLYDSRNQLNLFDF*
Ga0181517_1002816643300014160BogSITLFEKTPILQALQACDSQTEPLDPGNQLILFDF*
Ga0181517_1004278713300014160BogLTLFEKTRILRALQQIDSQDDLPFFSNQLNLFGL*
Ga0181517_1011570733300014160BogSLTLFEKTPILQALQRFDSQEELQNHSNQLILFDF*
Ga0181517_1036648333300014160BogSLTLFEKTPILRALQQINSKDDLPCSDNQLILFN*
Ga0181517_1049797623300014160BogSVTLFEKTPILRALQASDFENDLGDSGNQLILFDF*
Ga0181529_1019364113300014161BogSLTLFEKTRILRALQQIDSQDDLPFFSNQLNLFGL*
Ga0181528_1007835113300014167BogSTLFEKTPLLQALQPSDSDLNSMDSGNQLNLFDF*
Ga0181528_1036827013300014167BogSLTLFEKTPILRALQSIDSQDKLPCFANQMNLFNL*
Ga0181535_1059728813300014199BogSLTLFEKTPILQALQPSDSENDLLDSSNQLILFDF*
Ga0182018_10000271773300014489PalsaSVTLFEKTPILQVLQPPDSQEDLLSSANQLILFEL*
Ga0182018_1011982743300014489PalsaSITLFEKVPILQALQASDPHPDLLDQGNQLNLFDF*
Ga0182018_1045356313300014489PalsaSVTLFEKTPILQALQASDSDNDLLDVSNQLILFDF*
Ga0182010_1022374633300014490FenSVTLFEKTPILRALQASDFENELGDSGNQLILFDF*
Ga0182010_1071469523300014490FenSVTLFEKTPILRALQASDFEDNLDDSGNQLILFDF*
Ga0182010_1079981713300014490FenVTLFEKTPILRALQASDFENELGDSGNQLILFDF*
Ga0182014_1000017713300014491BogVTLFEKTPILQALHAPASDTDLLDPGNQLILFDF*
Ga0182014_1000076513300014491BogSLTLFEKTPILQALQTSDPDNDLGDNGNQLNLFDL*
Ga0182014_10004449143300014491BogLTQFEKTPILRALQQIDSQDDLPCFSNQLNLFSL*
Ga0182014_10005520113300014491BogVTLFEKTPILQPLQRDGFQEELSCHPNQLILFDF*
Ga0182014_1000750973300014491BogSVTLFEKTPILRALQRFDSQDELLTHSNQLILFDF*
Ga0182014_1004098513300014491BogSVTLFEKTPILQALHAPASDTDLLDPGNQLILFDF*
Ga0182014_1005038413300014491BogSLTQFEKTPILRALQQIDSQDDLPCFSNQLNLFSL*
Ga0182014_1010461423300014491BogSVTLFEKTPILRTLQEIDSDSDLYDPSNQLNLFSL*
Ga0182014_1012526913300014491BogSLTQFEKTPILQALQAPNSDTDLDDIDNQLILFDL*
Ga0182014_1015927213300014491BogSVTLFEKTPILQALQACDSGNDLSDPGNQLILFDF*
Ga0182014_1025623733300014491BogSVTLFEKTPILRALQRFDSQDELQTTSNQLILFDF*
Ga0182014_1026698713300014491BogLSVTLFEKVPVLQAFQASDSQIDLLDDGNQLILFD
Ga0182014_1038034013300014491BogVTLFEKTPILRTLQEIDSDSDLYDPSNQLNLFSL*
Ga0182013_1002675373300014492BogVTLFEKTPILRALQRFDSQDELLTHSNQLILFDF*
Ga0182013_1010533013300014492BogSLTLFEKTPILQALQAPSSQEILPDSGKQLILFDL*
Ga0182013_1022731953300014492BogSVTLFEKTPILQALQPPDSQEDSPDDSNQLNLFTL*
Ga0182016_1001893863300014493BogLTLFEKTPILQALQTADCENDLYNTGNQLILFDF*
Ga0182016_1003654543300014493BogITLFEKTTILQALQASDSQPDLPDQGNQLILFDF*
Ga0182016_1067002523300014493BogSLTLFEKTPVLRALHAFDSCNDLPDPGNQLILFDF*
Ga0182017_1026946933300014494FenVTLFEKTPILRALQAPDFENELGDSGNQLILFDF*
Ga0182017_1027411323300014494FenVTLFEKTPILRALQRYNSQDELEQSSNQLILFDF*
Ga0182017_1035027623300014494FenVTLFEKTPILRALQASDFENDLGDSGNQLILFDF*
Ga0182017_1059097513300014494FenSVTLFETTPILRALQAPDFENDLGDSGNQLILFDF*
Ga0182017_1060811123300014494FenSLTLFEKTPILRALQAISCDNDLDDLGNQLNLFGL*
Ga0182017_1096669013300014494FenSLTLFEKTPILRALQQIDSQLELPCPVNQLNLFGL*
Ga0182011_1004927013300014496FenSVTLFEKTPILRALQAPDFENELGDSGNQLILFDF*
Ga0182011_1055991713300014496FenSVTLFEKTPILRALQAPDSDSDLFDVGNQLILFDF*
Ga0182012_1001021613300014499BogSLTIFEKTPVLRALHAFDSCNDLPDPGNQLILFDF*
Ga0182012_1028799013300014499BogSVTLFEKTPILKALQQIYSQDDSPGSQNQMILFDF*
Ga0182012_1037397033300014499BogSVTLFEKTPILQALQASNSEEDLADSGNQLILFDF*
Ga0182024_1000785813300014501PermafrostLSLFEKMPILQALQPSESEIDFIDPGKQLILFDL*
Ga0182024_1001442513300014501PermafrostSLSLFEKMPILQALQPSESEIDFIDPGKQLILFDL*
Ga0182024_1003528513300014501PermafrostSLTLFEKTPILQALQTSNSENDLGDLSNQLILFDL*
Ga0182024_1004651873300014501PermafrostSVTLFEKTPILRALQTTDPQFDLPNSDNQLNLFSL*
Ga0182024_1066386223300014501PermafrostSITLFEKTPILQAPQTSDSDNDLGDISNQLILFDL*
Ga0182024_1083328613300014501PermafrostVTLFEKTPILQVLQPPDSQEDLLSSANQLILFEL*
Ga0182024_1198264323300014501PermafrostSVTLFEKTPLLEALQAPDSENDSPNTGNQLILFDF*
Ga0182021_1109878513300014502FenLTLFEKTPILRALQQIDSQLELPCPVNQLNLFGL*
Ga0181536_1030095823300014638BogLTLFEKTPILRALQRIASQDELPCLGNQLNLFSL*
Ga0181516_1004461713300014655BogLTLFEKTPISQALQTSNSDHNLDDIGNQLILFDL*
Ga0181516_1017965313300014655BogSLTQFEKTPILQALQPSNSETDLPDPENQLILFDL*
Ga0157377_1076699713300014745Miscanthus RhizosphereILSVTLFEKTPILRALQASDYENEPGDPGNQLILFNL*
Ga0182030_1040632113300014838BogSVTLFEKTAILRALQACDSDSDLVDIGNQLILFNF*
Ga0182030_1065213913300014838BogLTQFEKTPILQALQISDYDSNLDGSGNQLILFNF*
Ga0182030_1076469423300014838BogSLTLFEKTPILQALHPSDSENDLHDSSNQLILFDF*
Ga0182030_1087255523300014838BogVTLFEKTPILQALQACDSGNDLSDPGNQLILFDF*
Ga0182030_1100111523300014838BogSLTQFEKTPILQALQISDYDSNLDGSGNQLILFNF*
Ga0182027_1000847213300014839FenSVTLFEKTPILQALQRFDSQEELLTHPNQLILFDF*
Ga0182027_1010048073300014839FenSVTLFEKTPILQALQPSDSQDDLPAFANQLNLFEL*
Ga0182027_1015536413300014839FenVTLFEKTPILRALQASDFENELANPGNQLILFDF*
Ga0182027_1018623513300014839FenSLTLFEKTPILRALQQINSQDDSSLPANQLNLFNL*
Ga0182027_1021469443300014839FenSVTLFEKTPVLQALQAPDFENDLGDSANQLILFDF*
Ga0182027_1023257113300014839FenSVTLFEKTPILRALQASDFENELGDPGNQLILFDF*
Ga0182027_1033809513300014839FenSVTLFEKTPILQALHASDSENDLSDAGNQLILFDF*
Ga0182027_1034082433300014839FenLSVTLFEKTPILRALQASDFENELGDSGNQLILFDF*
Ga0182027_1035875543300014839FenLSVTLFETTPILRALQAPDFENDLGDSGNQLILFDF*
Ga0182027_1043522523300014839FenSVTLFEKTPILRALQAPDFENEIDDPGNQLILFDF*
Ga0182027_1060249813300014839FenLSRRTKTPILQAVQMSGYDYDLPDSGNQLILFDF*
Ga0182027_1060933513300014839FenSVTLFEKTPILQALQPSDSRDDLFDFANQLNLFDL*
Ga0182027_1065966013300014839FenSVTLFEKTPILRALQASDFANELSDPGNQLILFDF*
Ga0182027_1078211823300014839FenSVTLFEKTPILRALQPSDSENDLHQSGNQLILFNF*
Ga0182027_1118489513300014839FenQIFSVTLFEKTPILQALQPPDSQDDSLDFANQLNLFDL*
Ga0182027_1168016623300014839FenSVTLFEKTPILRALQASDFNRGLDESGNQLILFDL*
Ga0182027_1181764513300014839FenLTLFEKTPILRALQAISCDNDLDDLGNQLNLFGL*
Ga0182027_1210309813300014839FenSVTLFEKTPILRALQASDFENELANPGNQLILFDF*
Ga0182027_1215848713300014839FenLSLTLFEKTPILQALQQIDSQLELPCPANQLNLFGL*
Ga0180066_112732823300014873SoilLTLFEKTPILQALQASDSQEELLDPGNQLILFDF*
Ga0167662_103448323300015082Glacier Forefield SoilLSLTLFEKTPILQALQPPDSQDDSLGSPNQLNLFGL*
Ga0180075_102051523300015252SoilLSVTLFEKVPVLQAFQASDYQDELLDDGNQLILFDF*
Ga0163144_1004557213300015360Freshwater Microbial MatSVTLFEKTPILRAFQNLDSEDELDPHANQLNLFNL*
Ga0182036_1145064513300016270SoilVLSVTLFEKTPILRALQEPCFNDDLHGLGNQLILFDF
Ga0182032_1038264533300016357SoilSLTLFERVPILQALQPPVFENESGDDPNQLILFDF
Ga0187856_100489113300017925PeatlandSLTLFEKTPILQALQTSDCGKDLYDIGNQLILFDL
Ga0187848_1027555633300017935PeatlandSVTLFEKTPILRALQASDFENDLGDPGNQLILFDF
Ga0187850_1028205223300017941PeatlandSVTLFEKTPVLRALQATDSENDLVDSGNQLILFDF
Ga0187850_1036059413300017941PeatlandRIPRLSLTLFEKTPILQALQATDSQSDLNDSSNQLILFDF
Ga0187819_1048604723300017943Freshwater SedimentSITLFEKVPILQALQASDSQPDLPGSGNQLILFDF
Ga0187879_1010672623300017946PeatlandSLTLFEKTPILQALQPSDSEIDLFDSSNQLILFDF
Ga0187782_1055900233300017975Tropical PeatlandSVTIFEKTPILQALQASDSEIELVDPGNQLILFDF
Ga0181520_1000004713300017988BogSITLFEKTPILQALQPSNSDSNLYDSDNQLILFDF
Ga0181520_1000429613300017988BogSLTLFEKTPISQALQTSNSDHNLDDIGNQLILFDL
Ga0181520_1000442213300017988BogSVTLFEKTPILQVLQPGDFHFDLYDSRNQLNLFDF
Ga0181520_10004775303300017988BogSLTLFEKTPILQALQRFDSQEELQNHSNQLILFDF
Ga0181520_1002350673300017988BogSITQFEKTPILQALQETDNDNDLDDIGNQLILFDF
Ga0181520_1004629713300017988BogSLTLFEKTPILRALQTSDYDSNLGDTGNQLILFDL
Ga0181520_1016998233300017988BogSVTLFEKTPILRTLQEIDCNSDLYDTGNQLNLFSL
Ga0181520_1029443323300017988BogSLTQFEKTPILQALQKLGYESDLDDSGNQLILFNF
Ga0187891_111961613300017996PeatlandSVTLFEKTPILQALQPPDSQADLLISANQLILFPL
Ga0187891_128154413300017996PeatlandSVTLFEKTPILRALQPSDSDSDLFDIGNQLILFSL
Ga0187876_122225723300018003PeatlandSVTLFEKTPILRALRASDSCPGLLDPGNQLILFDF
Ga0187865_100263313300018004PeatlandSVTLFEKTPIVRALRPSDSCPDLPDPGNQLILFDF
Ga0187865_100645283300018004PeatlandSVTLFEKTPIPRALEASDSQDDPYENSNQLILFDL
Ga0187884_1005588433300018009PeatlandLSVTLFEKTPILQALQASDSENAPIDTGNQLILFD
Ga0187884_1011417323300018009PeatlandMLSLTLLEKTPILQALQPFDSESDLQGDSKQLVLFNF
Ga0187866_108376333300018015PeatlandVLSVTLFEKTPILQALQASDSESDLLDVGNQLILFDF
Ga0187872_1004984213300018017PeatlandSVTLFEKTPILQALQAPNSDSDLFDIGNQLILFDF
Ga0187889_1001462193300018023PeatlandLSVTLFEKTPILQALQPPDSQDDLPAFANQLNLFEL
Ga0187863_1084629013300018034PeatlandILSVTLFEKTPILQALQLYDSQYESDDNSKQLNLFDL
Ga0187875_1004101963300018035PeatlandSVTLFEKTPILQALQPSDSRDDLLDFANQLNLFDL
Ga0187875_1039877713300018035PeatlandILSLTLFEKTPILQALQPSDSEIDLFDSSNQLILFDF
Ga0187875_1058295423300018035PeatlandSLTLFEKTPILRTLQRLDANLELDDDDKQLILFTL
Ga0187855_1036180533300018038PeatlandLSVTLFEKTPILQALQPPDSQDDLLSSANQLILFPL
Ga0187887_1020834123300018043PeatlandSVTLFEKTPILQALQLDNSQNELYDSCNQLNLFNF
Ga0184626_1021405623300018053Groundwater SedimentSVTLFEKTPILQAFQAFDSQDNLVDCGNQLNLFDF
Ga0184615_1010389013300018059Groundwater SedimentQILSVTLFEKVPVLQAFQASDSQDELHDDGNQLILFDF
Ga0187893_1016538513300019487Microbial Mat On RocksSVTLFEKVPILRAFQTSDSQSDLLDSNNQLILFDF
Ga0182028_135104313300019788FenSVTLFEKTPILRALEASSYQDDPSENINQLILFDLVAGQ
Ga0193751_114841723300019888SoilLSVTLFEKTPILQALQTCDSDSNLVDIGNQLILFNF
Ga0193726_124703823300020021SoilLSLSLFEKTPILQAFQSSDSQSHLPDLSNQLILFDL
Ga0194111_1033161523300020083Freshwater LakeLSVTLFEKTPILRALQAPDSESDLRNVGNQLILFDF
Ga0163147_1040179233300020192Freshwater Microbial MatLSVTLFEKTPILQALQMPDSQNNLLDSGNQLNLWDF
Ga0163154_1048135723300020201Freshwater Microbial MatLSITLFEKMPILQALQASDSEFQLYEDPNQLTLFDF
Ga0163148_1049373223300020203Freshwater Microbial MatVSVTLFEKTPILRAFQNLDSEDELDPHANQLNLFNL
Ga0163148_1051413913300020203Freshwater Microbial MatSVTLFEKTPILRAFQNLDSEDELDPHANQLNLLNL
Ga0210395_1059982113300020582SoilLQILSVTLFEKTPLLQALQPSDSQEDSFDYSNQLSLFTL
Ga0210406_1030878313300021168SoilSVTLFEKTPILRALQACDSDNDLVDSGNQLILFNF
Ga0210383_1140729513300021407SoilLSLSLFEKMPILQALQPSDSQPELPDPGNQLILFDL
Ga0210390_1052222233300021474SoilLSLTLFEKTPILQALQKDHSQDELYAAPNQLILFDF
Ga0210398_1120689413300021477SoilLSVTLFEKTPILQALQPCDSQDFLADFSNQLNLFTL
Ga0210409_1158870913300021559SoilLSVTLFEKTPILRALQADDSQSDLLDHANQFMLFDL
Ga0126371_1263731523300021560Tropical Forest SoilILSVTLFEKTPVLRALQPPVSTNELLDFPNQLNLFSL
Ga0226658_1041970923300022222Freshwater Microbial MatSVSLFEKTPILQALQPPGSESDLLDTGKQLILFDF
Ga0224534_101883913300022524SoilLSVTLFEKTPILQALHAPASDTDLLDPGNQLILFDF
Ga0224534_103297123300022524SoilILSVTLFEKTPILQALHAPASDTDLLDPGNQLILFDF
Ga0224533_103840213300022526SoilLSLTQFEKTPILRALQQIDSQDDLPCFSNQLNLFSL
Ga0212124_1040732513300022553FreshwaterVSITLFEKTPILRALQGPDSRSDSLDPGNQLNLFDF
Ga0224531_100038513300022849SoilFSVTLFEKTPILRALQNFDSQDELLPFHNQLILFDF
Ga0224528_100309793300022861SoilLSLTLFEKTPILQALQTADCENDLYNTGNQLILFDF
Ga0224528_100694913300022861SoilILSLTLFEKTPILQALQTADCENDLYNTGNQLILFDF
Ga0224528_101845133300022861SoilILSLTLFEKTPILRALQTSDSDNDLGDNGNQLNLFNL
Ga0224528_102997333300022861SoilSVTLFEKTPILRALQNFDSQDELLPFHNQLILFDF
Ga0224526_107362713300022872SoilSVTLFEKTPILRALQRFDSNDELQPSPNQLILFDF
Ga0224526_108831613300022872SoilLSLTLFEKTPILRALQQINSQDDSSLPANQLNLFNL
Ga0224520_108484123300023075SoilLSLTLFEKTPILRALQQIDSQLELPCPVNQLNLFGL
Ga0224555_100345013300023088SoilSVTLFEKTPILQALHAPASDTDLLDPGNQLILFDF
Ga0224558_106299023300023090SoilFSLTLFEKTPILQVLQRFTSQEELQDSSNQLILFDF
Ga0224558_108390813300023090SoilFSVTLFEKTPILRALQRFDSQDELLTHSNQLILFDF
Ga0224558_114679823300023090SoilLSLTLFEKTPILRALQTFDVDEDLAENHNQLILFDF
Ga0224558_117435213300023090SoilIFSVTLFEKTPILRALQRFDSQDELQTTSNQLILFDF
Ga0224557_101668253300023101SoilFSVTLFEKTPILRALQRFDSNDELQPSPNQLILFDF
Ga0224529_100507133300023247SoilIFSVTLFEKTPILQALQPDDFHIDLYDSGNQLNLFDF
Ga0224529_100685013300023247SoilLSLTLFEKTPILRALQTSDSDNDLGDNGNQLNLFNL
Ga0224529_104258533300023247SoilSLTLFEKTPVLRALHAFDSCNDLPDPGNQLILFDF
Ga0224544_101219313300023250SoilLSVTLFEKTPILQALQASNSEDDLVDSGNQLILFDF
Ga0224535_112781013300023258SoilLSLTLFEKTPILRALQTSDSDNDLGGNGNQLNLFNL
Ga0224521_105322813300024233SoilFSVTLFEKTPILRALQRYNSQDELEQSSNQLILFDF
Ga0224521_112442213300024233SoilLSVTLFEKTPILRALQASDFENELGDSGNQLILFDF
Ga0208936_101441643300025404PeatlandFSMTLFEKTPILRALQQLDSYDNLPLDDNQLNLFDF
Ga0208321_102475713300025409PeatlandQILQVLSVILFEKTPILQALQASDSESDLLDVGNQLILFDF
Ga0208321_104364223300025409PeatlandLSVTLFEKTPVLRALQATDSENDLVDSGNQLILFDF
Ga0208189_103024333300025444PeatlandFSVTLFEKTPILRTLQRDGFQEELSYPPNQLILFDL
Ga0208037_102187823300025448PeatlandLSVTLFEKTPILRALRASDSCPGLLDPGNQLILFDF
Ga0208193_100325713300025463PeatlandLSVTLFEKTPILQALQPPDSQEELFSSANQLILFDL
Ga0208937_101431333300025506PeatlandLSVTLFEKTPILRALQASDFENDLGDPGNQLILFDF
Ga0208937_106493023300025506PeatlandLSVTLFEKTPILQALQASDSQGELLDHGNQLILFDF
Ga0208820_103487823300025576PeatlandILSVTLFEKTPILRALQASDFENDLGDPGNQLILFDF
Ga0209385_101859113300025650Arctic Peat SoilLSVTLFEKTPILRALQNSNSQSDLLDYSNQLILFNL
Ga0209385_111791423300025650Arctic Peat SoilQILQILSLTLFEKPPILQALQASDSQEEFLDSGNQLILFDF
Ga0209385_114485623300025650Arctic Peat SoilLSLTLFEKMPILQALQASDSDNILVDDGNQLILFDF
Ga0207933_100771633300025679Arctic Peat SoilVLLDPFEEKTPILQALQPTDSEELLPDFSNQLNLFNL
Ga0209507_115528323300025706Anaerobic Digestor SludgeLSVTLFEKTPILQVLSQHNGKDLEDEGPNQLELFD
Ga0209484_1014948723300025829Arctic Peat SoilLSLTLFEKTPILQALQASDSENSLLDDGNQLILFDF
Ga0209483_105129323300025862Arctic Peat SoilLSLTLFEKTPILQALQPSDSESDLSDQGNQLILFDF
Ga0209584_1027283623300025878Arctic Peat SoilLSVTLFEKTPILQALQAHDSQSDLLDHANQFILFDL
Ga0209540_1007019643300025888Arctic Peat SoilLSVTLFEKTPILRALQASDSENDLPDTGNQLILFDF
Ga0207680_1071231523300025903Switchgrass RhizosphereLSVTLFEKTPILQALQTFDMEENLLQDANQLILFNL
Ga0207684_1110293923300025910Corn, Switchgrass And Miscanthus RhizosphereLSVTLFEKTPILQALQPSDSQEDLLNNSNQLNLFTL
Ga0207661_1000033413300025944Corn RhizosphereILSLTLFEKTPILRALQASDSENDLGDSGNQLILFDF
Ga0209840_110112023300026223SoilLSVTLFEKTPILQALRVSDSDNDLLDVSNQLILFDF
Ga0247845_106157613300026451SoilFSVTLFEKTPILQALQPPDSQDDSLDFANQLNLFGL
Ga0257154_105846413300026467SoilLSVTLFEKAPILQALQTFDMEENLLQDANQLILFNL
Ga0257160_100683313300026489SoilLSVTLFEKTPILQALQTFDIDDNLLQDANQLILFNL
Ga0255350_100338343300026502SoilSLTLFEKTPILQALQTADCENDLYNTGNQLILFDF
Ga0255350_109187513300026502SoilLSITLFEKTPILQALQPTDSESNLYDSTNQLILFDF
Ga0257158_112252413300026515SoilLSVTLFEKTPILQALQTFDMEENLLPDANQLILFNL
Ga0209056_1048614913300026538SoilLQILSITLFEKTPILQAFQAFDSRDDLVNCGNQLNLFDF
Ga0209648_1026010033300026551Grasslands SoilLSVTLFEKTPILQALQASDSREELADPGNQLILFDF
Ga0209648_1029694613300026551Grasslands SoilLSVTLFEKTPILQALQASDSDTDLLDPGNQLILFDF
Ga0208827_103345613300027641Peatlands SoilILSGTLFEKTPILQALQASDSDFEVLHSGNQLILFDF
Ga0208827_105848723300027641Peatlands SoilLSLTLFEKTPILQALQAPDSREESLDPGNQLILFEF
Ga0209581_10001841633300027706Surface SoilILSVTLFEKTPIFRALQEPCSQEHLGDLGNQLILFDF
(restricted) Ga0233416_1033903613300027799SedimentLSLTLFEQTPILQALQASEPEIDLADSGNQLILFDL
Ga0209656_1044706823300027812Bog Forest SoilLSLSLFEKMPILQALQPSDSELNLPDPGNQLILFNL
Ga0209683_1045316023300027840Wetland SedimentLSVTLFEKTPVWRAFQARDSESDLGESRNQLNLFTL
Ga0209580_1052369223300027842Surface SoilLSLTLFEKTPILQALQAYDSQEELLDLGNQLILFDI
Ga0209180_1040549323300027846Vadose Zone SoilLSVTLFEKTPILQALQTFDIDHNLLQDANQLILFNL
Ga0209274_1034558823300027853SoilLSVTLFEKTPILQALQPLDSQQDLLSSANQLILFD
Ga0209517_1015682923300027854Peatlands SoilILSVTLFEKTPILQALQASTSQDDLLVSGNQLILFDL
Ga0209517_1016016913300027854Peatlands SoilILSLTLFEKTPILQALQAPDSQEESLDPGNQLILFEF
Ga0209517_1056672313300027854Peatlands SoilILSLTLFEKTPILQALQAPDSREESLDPGNQLILFEF
Ga0209283_1013694243300027875Vadose Zone SoilLSLTLFEKTPILQALQASDSQEELLGPSNQLNLFDF
Ga0209283_1090904423300027875Vadose Zone SoilLSVTLFEKTPILQAFQAFDSQGDLVDCGSQLNLFDF
Ga0209181_1098720613300027878FreshwaterQTLQVLSVSLFEKTPILQALQPPDSGSDLMDTGKQLILFDF
Ga0209590_1011482323300027882Vadose Zone SoilLSVTLFEKTPILQAFQAFGSQPDLVDSGNQLTLFDF
Ga0209450_1005346043300027885Freshwater Lake SedimentLSVTLFEKTPILRALAKADYTDPNYYTSNQLQLFD
Ga0209777_1005165513300027896Freshwater Lake SedimentLSVTLFEKTPILRALQAPDSDSDLFDVGNQLILFDF
Ga0209067_1068822023300027898WatershedsLSVTLFEKTPILQALQPFDSQEDFIDPANQLNLFDL
Ga0209629_1100460013300027984Termite GutLSVTLFEKTPILQALQQDHSQNELCNSGNQLILFDF
(restricted) Ga0233418_1010142013300027995SedimentLSVTLFEKTPILRALQASDSEDDLPTLGNQLILFDF
Ga0265292_100556373300028028Landfill LeachateLSVTLFEKTPILQALEGDDDDANITTIANQLNLFN
Ga0265296_102456713300028032GroundwaterVLSVTLFEKTPILQALEGDDDDANITTIANQLNLFN
(restricted) Ga0233417_1000163613300028043SedimentSVTLLEKTPILRALQASDSEDDLPTLGNQLILFDF
(restricted) Ga0233417_1039838923300028043SedimentSVTLFEKTPILRALQASDSEDDLPTLGNQLILFDF
Ga0255355_101272823300028068SoilFSVTLFEKTPILQVLQPDDFHVDLYDSGNQLNLFDF
Ga0255353_100581733300028070SoilSVTLFEKTPILQALQPDDFHIDLYDSGNQLNLFDF
Ga0302149_100528453300028552BogLSVTLFEKTPILQALQLDNSQNELYDSCNQLNLFNF
Ga0302144_1012672123300028560BogLSVTLFEKTPILQALQLYDSQYESDDNSKQLNLFDL
(restricted) Ga0255347_134384513300028593WastewaterFSVTLFEKVPISRAFQASNSQGDLPCPDNQLILFDF
Ga0302162_1008676613300028649FenLSVTLFEKTPILRALDASDSENDLGVPGNQLILFDF
Ga0265323_1006325613300028653RhizosphereLSLTQFEKTPILQALQMPDCDSDLAVPGNQLILFDF
Ga0257175_111014313300028673SoilLSITLLEKTPILSALHASGSNDDLLDAGHELILFDF
Ga0302267_10000127773300028745BogFSLTLFEKTPILQVLQRFNSQEELQGTSNQLILFDF
Ga0302267_1000072713300028745BogIFSLTLFEKTPILQVLQRFNSQEELQGTSNQLILFDF
Ga0302267_10002358223300028745BogLSLTLFEKTPILQALQDTDYHNDLGDIGNQLILFDF
Ga0302198_1000182713300028765BogILSLTLFEKTPILQALQDTDYHNDLGDIGNQLILFDF
Ga0302198_1009904413300028765BogFSLTLFEKTPISRALQQVDSQNDLPCPTNQLNLFNL
Ga0302201_1002172613300028785BogVFSVTLFEKTPILRALQPDDSQNDLHNSGNQLNLFDF
Ga0302201_1010903513300028785BogSVTLFEKTPILQALQLYDSQYESDDNSKQLNLFDL
Ga0302201_1011970413300028785BogLCLTQFEKTPILRALQQIDSQEDLPCFFNQLNLFDL
Ga0265338_1037961213300028800RhizosphereLSLTLFEKTPILQALQASDSQEEFLDPGNQLILFDF
Ga0265338_1042952713300028800RhizosphereLSVTLFEKTPILQALQASDSQEELPDHSNQLILFDF
Ga0302157_1012507413300028813BogSLTLFEKTPISRALQQVDSQNDLPCPTNQLNLFNL
Ga0302199_100756363300028860BogSLTLFEKTPILQALQDTDYHNDLGDIGNQLILFDF
Ga0302154_1040824713300028882BogTIRCVTLFEKTPILRALQPDDSQNDLHNSGNQLNLFDF
Ga0311329_1083652913300029907BogLSVTLFEKTPILQALQASNSENDSPDTCNQLILFDL
Ga0311361_10023841143300029911BogLSLTLFEKTPTLRALQASDADNDLGDISNQLILFDL
Ga0311361_1012013813300029911BogFSVTLFEKTPILRALQPDDSQNDLHNSGNQLNLFDF
Ga0311361_1035119813300029911BogVFSLTLFEKTPISRALQQVDSQNDLPCPTNQLNLFNL
Ga0311362_10003011383300029913BogLSLTQFEKTPILQALQKLGYESDLDDSGNQLILFNF
Ga0311362_1008851813300029913BogSLTLFEKTPILQVLQRFTSQEELQDSSNQLILFDF
Ga0311359_1075671613300029914BogSLTLFEKTPILRALQTSDSDNDLGDNGNQLNLFNL
Ga0311358_1001572813300029915BogILSLTQFEKTPILQALQKLGYESDLDDSGNQLILFNF
Ga0311363_1003607413300029922FenSLTLFEKTPTLRALQASDADNDLGDISNQLILFDL
Ga0311346_1131824623300029952BogSLSLFEKMPISQALQPSDSQPELPDPGNQLILFDL
Ga0311331_1084281413300029954BogLSVTLFEKTPILRALQASDFENELANPGNQLILFDF
Ga0302277_111229413300029982BogLSVTLFEKTPILQALQPPDSQQDLPSSANQLILFDL
Ga0311339_1054215413300029999PalsaQILSVTLFEKTPILRALQPSDSEEIALDFANQFNLFSL
Ga0311344_1036250113300030020BogLSVTLFEKTPILQALQASNSEEDLADSGNQLILFDF
Ga0302306_1035557413300030043PalsaLSVTLFEKTPILQAFQDAASQDDLPVDNNQLILFDF
Ga0302181_1028535213300030056PalsaLSLTLFEKTPILQALQISDSDNDLGDIGNQLILFDL
Ga0302176_1008529013300030057PalsaFSVTLFEKTPILRALQRFDSQDDLQTTFNQLILFDF
Ga0302185_1012052233300030508BogQILQILSLTQFEKTPILQALQAPNSDTDLDDIDNQLILFDL
Ga0311355_1050867313300030580PalsaLSLTLFEKTPILQALQTSDSDNDLGDIGNQLILFDL
Ga0311354_1088486533300030618PalsaLQILSLTLFEKTPILTALQPFDPESNLQNDGNQLILFNF
Ga0316363_1002095153300030659Peatlands SoilLSLTLFEKTPILQALQAPDSQEESLDPGNQLILFEF
Ga0170834_10051976123300031057Forest SoilSGTLFEKTPILQALQASDSQEQLTDPGNQLILFDF
Ga0170822_1160892623300031122Forest SoilILSLSRFEKMPILQALQPSDSESKSFDQGNQLILFDL
Ga0170823_1564512323300031128Forest SoilSVTLFEKTPILQALQASDSQEELTDPGNQLILFDF
Ga0170824_11693862013300031231Forest SoilILSVTLFEKTPILQALQTFDMEENLLQDANQLILFNL
Ga0302323_10061421213300031232FenLSVTLFEKTPILRALQACDSDRNLVDIGNQLILFNF
Ga0302307_1058641413300031233PalsaILSITLFEKTAILQALQPSDFPEDWPDFSKQLDLFKL
Ga0302325_1000755613300031234PalsaSLTLFEKTPILTALQPFDSESNLQNDGNQLILFNF
Ga0302325_1032167813300031234PalsaLQILSVTLFEKTPILRALQPSDSEEIPLDFANRLNLFSL
Ga0302325_1099421823300031234PalsaSVTLFEKTPILRALQPSDSEEIALDFANQLNLFSL
Ga0302324_10002523313300031236PalsaILSVTLYEKTPILQALHASGSGADLLDPGNQLILFDF
Ga0302324_10040083613300031236PalsaSVTLFEKTPILQALHASGSGADLLDPGNQLILFDF
Ga0302324_10183596313300031236PalsaLSVTLFEKTPILQALQPSDSQEDLLDNSNQLNLFNL
Ga0302187_1003059813300031259BogSVTLFEKTPILRALQPDDSQNDLHNSGNQLNLFDF
Ga0302140_1012108913300031261BogLSVTLFEKTPILQALQPSDSQENLLDNSNQLNLFNL
Ga0302140_1103603023300031261BogVFSLTLFEKTPILRALQKIDCRDDLPSQANQLILFNL
Ga0265316_1034423613300031344RhizosphereILSVTLFEKTPVLQALQAPDFENDLGDSANQLILFDF
Ga0302320_1002609513300031524BogILSLSLFEKMPISQALQPSDSQPELPDPGNQLILFDL
Ga0302320_1034142813300031524BogIFSVALFEKTPILRALQRFDSQNELQSDSNQLILFDF
Ga0302320_1088014213300031524BogILSVTLFEKTPILQALQASNSEEDLADSGNQLILFDF
Ga0302320_1097027813300031524BogLSLTLFEKTPVLRALHAFDSCNDLPDPGNQLILFDF
Ga0302326_1033495943300031525PalsaLSVTLFEKTPILQALHASGSGADLLDPGNQLILFDF
Ga0302326_1162122813300031525PalsaSVTLFEKTPILQALQPPDSQEELFSSANQLILFDL
Ga0302326_1246575913300031525PalsaLRLTLFEKTPILQALQPSDSEIDLFESSNQLILFNF
Ga0302326_1308461113300031525PalsaLSLTLFEKTPILQALQAPDSQEEFLDPGNQLILFDF
Ga0302326_1339852213300031525PalsaLSVTLFEKTPILQALQSSDSQEELPGPDNQLILFDF
Ga0247727_1003101263300031576BiofilmLSITPFEQMPILRALQASDSGNNLLDPGNQLNLWDF
Ga0265313_1007424943300031595RhizosphereLSVTLFEKTPILQALQSSDSQEELPGSGNQLILFDF
Ga0307374_1003372813300031670SoilLSLTLFEKAPILQALQPSDSDNDLGGNGNQLNLFDL
Ga0307374_1007081663300031670SoilILSLTLFEKAPILQALQPSDSDNDLGGNGNQLNLFDL
Ga0307374_1015974913300031670SoilSVTLFEKTPILQALQTFDLKANLLADVNQLILFNF
Ga0307373_1003398013300031672SoilVTLTTLFEKAPILQALQPSDSDNDLGGNGNQLNLFDL
Ga0315291_1010665433300031707SedimentLSVTLFEKTPILRAFEHCDYRIDLPDTCNQLTLFGL
Ga0315291_1045449113300031707SedimentLQILSVTLFEKVPILQVLQASDSEENLVDAGNQLILFDF
Ga0315291_1099095823300031707SedimentLSVTHFEKTPILRALQACDPRDDLHEDSNQLILFDF
Ga0310686_10097646623300031708SoilLSVTLFEKTPILQALQPLDMEGNPLPDSNQLILFNR
Ga0310686_11877929713300031708SoilSVTLFEKTPILQVLQPPDSQEDLLSSTNQLILFPL
Ga0310686_11960884023300031708SoilLQILSVTLFEKTPILQVLQPPDSQEDLLSSTNQLILFPL
Ga0315293_1083804313300031746SedimentLSLMLFEKTPILQALQPSDSQENLLGNPNQLILFDF
Ga0315293_1088411933300031746SedimentVLSVTLFEKTPILRAFEHCDYRIDLPDTCNQLTLFGL
Ga0315288_1016510313300031772SedimentLSVTLFEKTPILRALQASDSESDLLDVGNQLILFDF
Ga0302319_1022965453300031788BogILSLTLFEKTPILQALQPFDSQNELPDNGKQLILFDF
Ga0302319_1038963413300031788BogFSVTLFEKTPILRALQRFDSQDELQTNSNQLILFDF
Ga0302319_1121851513300031788BogLSVTLFEKTPILQALQACDSGNDLSDPGNQLILFDF
Ga0310121_1044590813300031801MarineLSVTLFEKTPILQALQPSDSHENSLDDPNQLILFDF
Ga0310121_1056735713300031801MarineLLQILSVTLFEKTPILQALQPSDSHENSLDDPNQLILFYF
Ga0310123_1001056983300031802MarineILSVTLFEKTPILQALQPSDSHENSLDDPNQLILFDF
Ga0310123_1004650713300031802MarineQILSVTLFEKTPILQALQPADSHENSLDDPNQLILFDF
Ga0310123_1008175413300031802MarineILQILSVTLFEKTPILQTLQPSDSHENSLDAPNQLILFDF
Ga0310123_1013091013300031802MarineSVTLFEKTPILQALQPSDSHENSLDDPNQLILFDF
Ga0310120_1004984353300031803MarineLQILSVTLFEKTPILQALQPSDSHENSLDGPNWLILFYF
Ga0310120_1006457813300031803MarineSVTLFEKTPILQALQPADSHENSLDDPNQLILFDF
Ga0310120_1009615133300031803MarineLQILSVTLFEKTPILQALQPSDSHENSLDDPNQLILFDF
Ga0316217_1002131863300031813FreshwaterILSLTQFEKTPILQALQKLGYESDLDDSGNQLILLNF
Ga0315280_1001283613300031862SedimentSVTLFEKTPILRAFEHCDYRIDLPDTCNQLTLFGL
(restricted) Ga0315314_109158123300031877SedimentVLSVTLFEKVPILQALQASDSRDDLPCPDNQLVLFEF
Ga0315285_1012402933300031885SedimentLSVTLFEKTPILQALPASDSESDLRDVGNQLILFD
Ga0315285_1034534423300031885SedimentSVTLFEKTPILQALPASDSESDLRDVGNQLILFDF
Ga0302322_10311240213300031902FenLSVTLFETTPILRALQAPDFENDLGDSGNQLILFDF
Ga0315289_10004799143300032046SedimentSVTLFEKTPILRALQASDSESDLRDVGNQLILFDF
Ga0315289_10005532223300032046SedimentLSVTLFEKTPILQALPASDSESDLRDVGNQLILFDF
Ga0315289_1011907313300032046SedimentVLSVTLFEKTPILRALQASDSESDLLDVGNQLILFDF
Ga0315289_1023676833300032046SedimentLSVTLFEKTPILQALQASDSESDLRDVGNQLILFDF
Ga0315284_1021226933300032053SedimentLSVTLFEKTPILQALQASDSESDLRDVGNQFILFDF
Ga0318533_1052428423300032059SoilQILSVTLFEKTRILQASDSECDLLDSSNQLILFDL
Ga0315279_1002334113300032070SedimentVLSVTLFEKTPILRAFEHCDYRIDLPDTCNQLILFGL
Ga0315279_1029841913300032070SedimentLSVTLFEKTPILRAFEHCDYRIDLPDTCNQLILFGL
Ga0315277_1010760313300032118SedimentLSVTLFEKTPILRALQACDPRDDLHEDSNQLILFDF
Ga0315295_1164667913300032156SedimentQILSVTLFEKTPILQALQASDSEENLVEDANQLILFDF
Ga0311301_1021995753300032160Peatlands SoilLSITLFEKTPILRALQACDSQNDSLDLGNQLILFDF
Ga0311301_1044064123300032160Peatlands SoilLSVTLFEKTPILQALQASTSQDDLLVSGNQLILFDL
Ga0311301_1099227223300032160Peatlands SoilSVTLFEKTPILQALQASTSQDDLMVSGNQLILFDL
Ga0311301_1186149813300032160Peatlands SoilLSVTLFEKTPILQALQPSDSQEDPFDHSNQLSLFTL
Ga0306920_10202752813300032261SoilLSLTLFEKVPILQALQPSDSQNESDQDPNQLILFDF
Ga0316222_100696583300032561FreshwaterLSVTLFEKTPVLQALQLDNSQTDLYDSCNQLNLFDF
Ga0335082_1052167313300032782SoilLSVTLFEKTPILQALQTSGSNNDLLDPGNQLILFDF
Ga0335079_1098486913300032783SoilLSVTLFEKTPILQALQASDSNNELLDPGNQLILFDF
Ga0335079_1189005713300032783SoilLSITLFEKVPILQALQASDSQSDLLNPGNQLNLFDS
Ga0335079_1202809213300032783SoilILSITLFEKVPILQALQASDSQSDLLNPGNQLNLFDS
Ga0335078_1242071613300032805SoilLSVTLFERTPILRALQEPDSANNLGDLGNQLILFDL
Ga0335070_1201937313300032829SoilLSLSLFEKTPILQALQRIDSQSDLPATINQLNLFNL
Ga0335069_1190857713300032893SoilLSVTLFEKTPILRALQASDFENDLGDSPNQLTLFDF
Ga0335069_1222753413300032893SoilLSVTLFEKTPILQALQPPDSQENLVGSANQLNLFSL
Ga0335074_1078840333300032895SoilIFSVILFEKTPILRALQRDDFINELHGSASQLILFDF
Ga0334722_1011347133300033233SedimentLSVTFFEKTPILRALQAPGSEDDLFDVGNQLILFDF
Ga0326728_1000041813300033402Peat SoilLSLTLFEKTPILQALQQIDSQLELTCSGNQLNLFSL
Ga0326728_1003237083300033402Peat SoilVLSLTLFEKTPILQALQQIDSQLELTCSGNQLNLFSL
Ga0326728_1016220213300033402Peat SoilVLSLTLFEKTPILRALQQINSKDDLPCSDNQLILFN
Ga0326727_1099913323300033405Peat SoilLSLTLFEKTPILRALQQINSKDDLPCSDNQLILFN
Ga0316626_1191398913300033485SoilLSVTLFEKTPILQALQPSDSQENLLVSPNQLILFDF
Ga0316628_10394970413300033513SoilILSVTLFEKTPVLRALQASGSQEELREDCNQLILFDF
Ga0334828_011919_3_1133300033822SoilLSITLFEKTTILQALQASDSQPDLPDQGNQLILFDF
Ga0334828_042908_1167_12773300033822SoilLSITLFEKTTILQALQASDSQPDLPDPGNQLILFDF
Ga0334790_015320_3582_36923300033887SoilLSLTLFEKTPILQALQTSNSENDLGDLSNQLILFDL
Ga0334790_056154_1330_14373300033887SoilSLTLFEKTPILQALQTSNSENDLGDLSNQLILFDL
Ga0334790_130528_665_7753300033887SoilLSLTLFEKTPILQALQASDSQEDSLDPGNQLILFEF
Ga0371488_0491814_1_1113300033983Peat SoilLSLTLFEKTPILRALQQIDSEDDLPCFSNQLNLFSL
Ga0364934_0024368_3_1133300034178SedimentLSLTLFEKTPILRALQPSNSQEDLGDFAKQLNLFNL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.