| Basic Information | |
|---|---|
| Family ID | F003968 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 459 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRMLRSAYLSRIVPDSARAQTILALLLWSGVTVFIFGILIDLFR |
| Number of Associated Samples | 250 |
| Number of Associated Scaffolds | 459 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.72 % |
| % of genes near scaffold ends (potentially truncated) | 28.76 % |
| % of genes from short scaffolds (< 2000 bps) | 81.48 % |
| Associated GOLD sequencing projects | 228 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.610 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.401 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.730 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.516 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.94% β-sheet: 0.00% Coil/Unstructured: 43.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 459 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 48.80 |
| PF00561 | Abhydrolase_1 | 16.34 |
| PF00571 | CBS | 5.23 |
| PF12697 | Abhydrolase_6 | 2.61 |
| PF09361 | Phasin_2 | 2.40 |
| PF01957 | NfeD | 1.53 |
| PF00005 | ABC_tran | 0.87 |
| PF02265 | S1-P1_nuclease | 0.87 |
| PF07040 | DUF1326 | 0.87 |
| PF04069 | OpuAC | 0.65 |
| PF09948 | DUF2182 | 0.65 |
| PF00126 | HTH_1 | 0.44 |
| PF00156 | Pribosyltran | 0.44 |
| PF01145 | Band_7 | 0.44 |
| PF13602 | ADH_zinc_N_2 | 0.22 |
| PF00486 | Trans_reg_C | 0.22 |
| PF01609 | DDE_Tnp_1 | 0.22 |
| PF00221 | Lyase_aromatic | 0.22 |
| PF13518 | HTH_28 | 0.22 |
| PF00848 | Ring_hydroxyl_A | 0.22 |
| PF03992 | ABM | 0.22 |
| PF00801 | PKD | 0.22 |
| PF00355 | Rieske | 0.22 |
| PF00296 | Bac_luciferase | 0.22 |
| PF00990 | GGDEF | 0.22 |
| PF00866 | Ring_hydroxyl_B | 0.22 |
| PF14361 | RsbRD_N | 0.22 |
| COG ID | Name | Functional Category | % Frequency in 459 Family Scaffolds |
|---|---|---|---|
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.87 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 0.44 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.22 |
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 0.22 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.22 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.22 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.22 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.22 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.22 |
| COG5517 | 3-phenylpropionate/cinnamic acid dioxygenase, small subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.22 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.22 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.61 % |
| Unclassified | root | N/A | 19.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS401ADQEV | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300001160|JGI12654J13325_1003653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 968 | Open in IMG/M |
| 3300001545|JGI12630J15595_10106873 | Not Available | 551 | Open in IMG/M |
| 3300001867|JGI12627J18819_10125436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1053 | Open in IMG/M |
| 3300001867|JGI12627J18819_10292140 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300002914|JGI25617J43924_10068299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1299 | Open in IMG/M |
| 3300003218|JGI26339J46600_10142324 | Not Available | 562 | Open in IMG/M |
| 3300003219|JGI26341J46601_10000215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 17750 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10038104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1781 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10120464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1052 | Open in IMG/M |
| 3300004080|Ga0062385_10304333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300004080|Ga0062385_10583896 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300004081|Ga0063454_100789108 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300004091|Ga0062387_100178370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1258 | Open in IMG/M |
| 3300004152|Ga0062386_100007376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7717 | Open in IMG/M |
| 3300004152|Ga0062386_100350924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
| 3300004152|Ga0062386_100539862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 949 | Open in IMG/M |
| 3300004152|Ga0062386_101410635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300004633|Ga0066395_10125930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1270 | Open in IMG/M |
| 3300004633|Ga0066395_10207534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1029 | Open in IMG/M |
| 3300004633|Ga0066395_10244598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 959 | Open in IMG/M |
| 3300005167|Ga0066672_10728384 | Not Available | 632 | Open in IMG/M |
| 3300005171|Ga0066677_10142603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1306 | Open in IMG/M |
| 3300005171|Ga0066677_10211841 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300005176|Ga0066679_10912948 | Not Available | 552 | Open in IMG/M |
| 3300005177|Ga0066690_10044423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2679 | Open in IMG/M |
| 3300005181|Ga0066678_10811712 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005184|Ga0066671_10680957 | Not Available | 666 | Open in IMG/M |
| 3300005332|Ga0066388_100048881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4310 | Open in IMG/M |
| 3300005332|Ga0066388_100459133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1915 | Open in IMG/M |
| 3300005332|Ga0066388_101004604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1398 | Open in IMG/M |
| 3300005332|Ga0066388_101760347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1100 | Open in IMG/M |
| 3300005332|Ga0066388_101796698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1090 | Open in IMG/M |
| 3300005332|Ga0066388_102974997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 866 | Open in IMG/M |
| 3300005332|Ga0066388_103269227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 828 | Open in IMG/M |
| 3300005332|Ga0066388_103508847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
| 3300005332|Ga0066388_104096467 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300005332|Ga0066388_104961676 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005332|Ga0066388_106658043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300005332|Ga0066388_106970649 | Not Available | 569 | Open in IMG/M |
| 3300005332|Ga0066388_107088270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300005363|Ga0008090_15075550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300005434|Ga0070709_10013742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4559 | Open in IMG/M |
| 3300005434|Ga0070709_10553095 | Not Available | 881 | Open in IMG/M |
| 3300005435|Ga0070714_101853665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300005436|Ga0070713_100034030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4089 | Open in IMG/M |
| 3300005436|Ga0070713_100844636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 879 | Open in IMG/M |
| 3300005436|Ga0070713_101223767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300005437|Ga0070710_10798917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300005439|Ga0070711_101817224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300005445|Ga0070708_101670016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300005518|Ga0070699_100206052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 1750 | Open in IMG/M |
| 3300005518|Ga0070699_102094443 | Not Available | 517 | Open in IMG/M |
| 3300005557|Ga0066704_10777129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300005559|Ga0066700_10241478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1260 | Open in IMG/M |
| 3300005576|Ga0066708_10023098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3217 | Open in IMG/M |
| 3300005598|Ga0066706_10433527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1047 | Open in IMG/M |
| 3300005602|Ga0070762_10318333 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300005764|Ga0066903_100161825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3248 | Open in IMG/M |
| 3300005764|Ga0066903_100285664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2592 | Open in IMG/M |
| 3300005764|Ga0066903_100327787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2452 | Open in IMG/M |
| 3300005764|Ga0066903_100327875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2452 | Open in IMG/M |
| 3300005764|Ga0066903_100947325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1565 | Open in IMG/M |
| 3300005764|Ga0066903_102353291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
| 3300005764|Ga0066903_102555845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 989 | Open in IMG/M |
| 3300005764|Ga0066903_105374005 | Not Available | 676 | Open in IMG/M |
| 3300005764|Ga0066903_105703677 | Not Available | 655 | Open in IMG/M |
| 3300005764|Ga0066903_105785816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300005921|Ga0070766_10241250 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300005983|Ga0081540_1003326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12747 | Open in IMG/M |
| 3300006028|Ga0070717_10002097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 13974 | Open in IMG/M |
| 3300006028|Ga0070717_10518361 | Not Available | 1078 | Open in IMG/M |
| 3300006046|Ga0066652_100684160 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300006175|Ga0070712_100041916 | All Organisms → cellular organisms → Bacteria | 3145 | Open in IMG/M |
| 3300006175|Ga0070712_101402163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300006176|Ga0070765_100110018 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
| 3300006755|Ga0079222_11178872 | Not Available | 683 | Open in IMG/M |
| 3300006755|Ga0079222_11866983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300006804|Ga0079221_11706675 | Not Available | 513 | Open in IMG/M |
| 3300006871|Ga0075434_100141561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2425 | Open in IMG/M |
| 3300006954|Ga0079219_11933615 | Not Available | 558 | Open in IMG/M |
| 3300007255|Ga0099791_10165107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1038 | Open in IMG/M |
| 3300007255|Ga0099791_10189630 | Not Available | 967 | Open in IMG/M |
| 3300007258|Ga0099793_10096207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1365 | Open in IMG/M |
| 3300007258|Ga0099793_10111142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1275 | Open in IMG/M |
| 3300007788|Ga0099795_10134057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1002 | Open in IMG/M |
| 3300009012|Ga0066710_101004161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1288 | Open in IMG/M |
| 3300009012|Ga0066710_101666034 | Not Available | 973 | Open in IMG/M |
| 3300009012|Ga0066710_103917830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300009038|Ga0099829_10004622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 8234 | Open in IMG/M |
| 3300009038|Ga0099829_10208928 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300009038|Ga0099829_10518581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 990 | Open in IMG/M |
| 3300009090|Ga0099827_10824981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300009090|Ga0099827_12006680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300009098|Ga0105245_11855742 | Not Available | 656 | Open in IMG/M |
| 3300009137|Ga0066709_100706233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1451 | Open in IMG/M |
| 3300009143|Ga0099792_10600361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 701 | Open in IMG/M |
| 3300009792|Ga0126374_10072552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1848 | Open in IMG/M |
| 3300009792|Ga0126374_10194494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1277 | Open in IMG/M |
| 3300009792|Ga0126374_11283454 | Not Available | 591 | Open in IMG/M |
| 3300010043|Ga0126380_10340993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1086 | Open in IMG/M |
| 3300010046|Ga0126384_10010226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5823 | Open in IMG/M |
| 3300010046|Ga0126384_10863887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300010048|Ga0126373_10050153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3707 | Open in IMG/M |
| 3300010048|Ga0126373_10205780 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300010048|Ga0126373_10713262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1062 | Open in IMG/M |
| 3300010048|Ga0126373_12074980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300010048|Ga0126373_12150816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 619 | Open in IMG/M |
| 3300010048|Ga0126373_12669522 | Not Available | 557 | Open in IMG/M |
| 3300010048|Ga0126373_12888048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300010152|Ga0126318_10173693 | Not Available | 740 | Open in IMG/M |
| 3300010154|Ga0127503_10388957 | Not Available | 839 | Open in IMG/M |
| 3300010154|Ga0127503_10414522 | Not Available | 530 | Open in IMG/M |
| 3300010154|Ga0127503_11302165 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010162|Ga0131853_10238604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2067 | Open in IMG/M |
| 3300010162|Ga0131853_10755918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300010339|Ga0074046_10048954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2813 | Open in IMG/M |
| 3300010341|Ga0074045_10187226 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300010343|Ga0074044_10785592 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300010358|Ga0126370_10580754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
| 3300010359|Ga0126376_10681759 | Not Available | 986 | Open in IMG/M |
| 3300010360|Ga0126372_10078001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2392 | Open in IMG/M |
| 3300010360|Ga0126372_10395554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1259 | Open in IMG/M |
| 3300010360|Ga0126372_13028830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300010361|Ga0126378_10091322 | All Organisms → cellular organisms → Bacteria | 2979 | Open in IMG/M |
| 3300010361|Ga0126378_10144358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2415 | Open in IMG/M |
| 3300010361|Ga0126378_10266200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1811 | Open in IMG/M |
| 3300010361|Ga0126378_10695627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1128 | Open in IMG/M |
| 3300010361|Ga0126378_10877503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1004 | Open in IMG/M |
| 3300010361|Ga0126378_11710290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300010362|Ga0126377_12511621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300010366|Ga0126379_10046735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3533 | Open in IMG/M |
| 3300010366|Ga0126379_13614497 | Not Available | 518 | Open in IMG/M |
| 3300010376|Ga0126381_100099472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3709 | Open in IMG/M |
| 3300010376|Ga0126381_100142793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3131 | Open in IMG/M |
| 3300010376|Ga0126381_100196028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2696 | Open in IMG/M |
| 3300010376|Ga0126381_100199414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2675 | Open in IMG/M |
| 3300010376|Ga0126381_100749791 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300010376|Ga0126381_101179395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
| 3300010376|Ga0126381_101748571 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300010376|Ga0126381_102804535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300010379|Ga0136449_103456628 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300010398|Ga0126383_10706798 | Not Available | 1087 | Open in IMG/M |
| 3300010398|Ga0126383_10946879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300010863|Ga0124850_1021741 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
| 3300011120|Ga0150983_11435481 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300011120|Ga0150983_11724658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 555 | Open in IMG/M |
| 3300011120|Ga0150983_14195504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 539 | Open in IMG/M |
| 3300011120|Ga0150983_14915428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300011120|Ga0150983_15373692 | Not Available | 1047 | Open in IMG/M |
| 3300011270|Ga0137391_11349409 | Not Available | 560 | Open in IMG/M |
| 3300011271|Ga0137393_10127705 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300011271|Ga0137393_10251383 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300012200|Ga0137382_10951877 | Not Available | 618 | Open in IMG/M |
| 3300012200|Ga0137382_10954478 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300012202|Ga0137363_11049375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300012205|Ga0137362_10387704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1210 | Open in IMG/M |
| 3300012205|Ga0137362_11298836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300012208|Ga0137376_11195069 | Not Available | 650 | Open in IMG/M |
| 3300012211|Ga0137377_10242279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1732 | Open in IMG/M |
| 3300012212|Ga0150985_100817088 | Not Available | 614 | Open in IMG/M |
| 3300012354|Ga0137366_11172737 | Not Available | 524 | Open in IMG/M |
| 3300012361|Ga0137360_10546648 | Not Available | 989 | Open in IMG/M |
| 3300012361|Ga0137360_11307972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300012362|Ga0137361_10040271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3785 | Open in IMG/M |
| 3300012362|Ga0137361_10109497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2417 | Open in IMG/M |
| 3300012362|Ga0137361_10515926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
| 3300012469|Ga0150984_101328972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300012469|Ga0150984_120978633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2671 | Open in IMG/M |
| 3300012917|Ga0137395_10714570 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300012927|Ga0137416_10495828 | Not Available | 1051 | Open in IMG/M |
| 3300012929|Ga0137404_11857168 | Not Available | 561 | Open in IMG/M |
| 3300012948|Ga0126375_10732789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300012971|Ga0126369_11595272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300012971|Ga0126369_11808808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300015245|Ga0137409_10318971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1362 | Open in IMG/M |
| 3300016270|Ga0182036_10092668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2032 | Open in IMG/M |
| 3300016270|Ga0182036_10268604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1285 | Open in IMG/M |
| 3300016270|Ga0182036_10900272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300016294|Ga0182041_10210995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1554 | Open in IMG/M |
| 3300016294|Ga0182041_10559618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1000 | Open in IMG/M |
| 3300016294|Ga0182041_10927023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300016294|Ga0182041_11432353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300016319|Ga0182033_10431736 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300016319|Ga0182033_11903166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300016341|Ga0182035_10062844 | All Organisms → cellular organisms → Bacteria | 2576 | Open in IMG/M |
| 3300016341|Ga0182035_10101839 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
| 3300016341|Ga0182035_10368445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1199 | Open in IMG/M |
| 3300016341|Ga0182035_10928366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300016357|Ga0182032_10561386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 945 | Open in IMG/M |
| 3300016357|Ga0182032_11982846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300016387|Ga0182040_11367344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300016387|Ga0182040_11824900 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300016404|Ga0182037_10007263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 6235 | Open in IMG/M |
| 3300016404|Ga0182037_11276619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300016404|Ga0182037_11678756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300016422|Ga0182039_11456402 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300016445|Ga0182038_10685051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
| 3300016445|Ga0182038_10690151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
| 3300017822|Ga0187802_10175042 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300017943|Ga0187819_10043742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2653 | Open in IMG/M |
| 3300017970|Ga0187783_10353350 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300017970|Ga0187783_10567669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300017970|Ga0187783_10874716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300017974|Ga0187777_10555825 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300017975|Ga0187782_10694700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
| 3300018006|Ga0187804_10348541 | Not Available | 650 | Open in IMG/M |
| 3300018086|Ga0187769_10092491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2163 | Open in IMG/M |
| 3300018482|Ga0066669_10375586 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300018482|Ga0066669_10956453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 771 | Open in IMG/M |
| 3300020579|Ga0210407_10000762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 33627 | Open in IMG/M |
| 3300020579|Ga0210407_10017527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 5308 | Open in IMG/M |
| 3300020580|Ga0210403_10178673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1739 | Open in IMG/M |
| 3300020580|Ga0210403_10345285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1218 | Open in IMG/M |
| 3300020580|Ga0210403_10892024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300020582|Ga0210395_10358582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1097 | Open in IMG/M |
| 3300021086|Ga0179596_10724610 | Not Available | 503 | Open in IMG/M |
| 3300021088|Ga0210404_10074642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1656 | Open in IMG/M |
| 3300021168|Ga0210406_10437528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1043 | Open in IMG/M |
| 3300021171|Ga0210405_10473982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 983 | Open in IMG/M |
| 3300021171|Ga0210405_10495681 | Not Available | 957 | Open in IMG/M |
| 3300021171|Ga0210405_11125807 | Not Available | 585 | Open in IMG/M |
| 3300021178|Ga0210408_10218126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
| 3300021180|Ga0210396_10601144 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300021358|Ga0213873_10059338 | Not Available | 1032 | Open in IMG/M |
| 3300021358|Ga0213873_10227301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300021358|Ga0213873_10304449 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021361|Ga0213872_10245438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300021361|Ga0213872_10272212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300021362|Ga0213882_10100366 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300021362|Ga0213882_10375698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300021374|Ga0213881_10003451 | All Organisms → cellular organisms → Bacteria | 6703 | Open in IMG/M |
| 3300021377|Ga0213874_10013377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2125 | Open in IMG/M |
| 3300021384|Ga0213876_10492740 | Not Available | 652 | Open in IMG/M |
| 3300021404|Ga0210389_10246729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1396 | Open in IMG/M |
| 3300021404|Ga0210389_10307379 | Not Available | 1243 | Open in IMG/M |
| 3300021405|Ga0210387_10249594 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300021405|Ga0210387_11564056 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300021420|Ga0210394_11133355 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300021432|Ga0210384_11462450 | Not Available | 589 | Open in IMG/M |
| 3300021439|Ga0213879_10006300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2388 | Open in IMG/M |
| 3300021439|Ga0213879_10045482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1148 | Open in IMG/M |
| 3300021439|Ga0213879_10082329 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300021439|Ga0213879_10083796 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300021441|Ga0213871_10089724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 890 | Open in IMG/M |
| 3300021441|Ga0213871_10185027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300021444|Ga0213878_10024905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2230 | Open in IMG/M |
| 3300021476|Ga0187846_10000532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 22120 | Open in IMG/M |
| 3300021476|Ga0187846_10026059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2679 | Open in IMG/M |
| 3300021476|Ga0187846_10026520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 2652 | Open in IMG/M |
| 3300021476|Ga0187846_10065426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1591 | Open in IMG/M |
| 3300021476|Ga0187846_10233879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300021476|Ga0187846_10261909 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300021476|Ga0187846_10298234 | Not Available | 667 | Open in IMG/M |
| 3300021476|Ga0187846_10464834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300021478|Ga0210402_10678710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 953 | Open in IMG/M |
| 3300021479|Ga0210410_10355438 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300021560|Ga0126371_10000649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 28969 | Open in IMG/M |
| 3300021560|Ga0126371_10007045 | All Organisms → cellular organisms → Bacteria | 10035 | Open in IMG/M |
| 3300021560|Ga0126371_10037385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4585 | Open in IMG/M |
| 3300021560|Ga0126371_10041639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 4354 | Open in IMG/M |
| 3300021560|Ga0126371_10045120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4198 | Open in IMG/M |
| 3300021560|Ga0126371_10049464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4020 | Open in IMG/M |
| 3300021560|Ga0126371_10095339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2951 | Open in IMG/M |
| 3300021560|Ga0126371_10169305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2260 | Open in IMG/M |
| 3300021560|Ga0126371_10196712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2109 | Open in IMG/M |
| 3300021560|Ga0126371_10256571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1864 | Open in IMG/M |
| 3300021560|Ga0126371_10510662 | Not Available | 1350 | Open in IMG/M |
| 3300021560|Ga0126371_10571186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1280 | Open in IMG/M |
| 3300021560|Ga0126371_10704135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1158 | Open in IMG/M |
| 3300021560|Ga0126371_11180724 | Not Available | 902 | Open in IMG/M |
| 3300021560|Ga0126371_11258610 | Not Available | 874 | Open in IMG/M |
| 3300021560|Ga0126371_11683908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300021560|Ga0126371_12217415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300021560|Ga0126371_13520080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300022501|Ga0242645_1030898 | Not Available | 509 | Open in IMG/M |
| 3300022507|Ga0222729_1067840 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300022510|Ga0242652_1039484 | Not Available | 570 | Open in IMG/M |
| 3300022510|Ga0242652_1052124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300022512|Ga0242676_1005590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1013 | Open in IMG/M |
| 3300022527|Ga0242664_1104037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300022527|Ga0242664_1129351 | Not Available | 542 | Open in IMG/M |
| 3300022528|Ga0242669_1084148 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300022531|Ga0242660_1061390 | Not Available | 845 | Open in IMG/M |
| 3300022533|Ga0242662_10045261 | Not Available | 1117 | Open in IMG/M |
| 3300022533|Ga0242662_10207411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300022533|Ga0242662_10233248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300022533|Ga0242662_10253219 | Not Available | 572 | Open in IMG/M |
| 3300022724|Ga0242665_10037028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1234 | Open in IMG/M |
| 3300022724|Ga0242665_10328310 | Not Available | 542 | Open in IMG/M |
| 3300022726|Ga0242654_10092314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300022726|Ga0242654_10150718 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300025906|Ga0207699_10406322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 970 | Open in IMG/M |
| 3300025916|Ga0207663_10159913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1589 | Open in IMG/M |
| 3300025922|Ga0207646_10586920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
| 3300026489|Ga0257160_1101766 | Not Available | 518 | Open in IMG/M |
| 3300026530|Ga0209807_1128503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1014 | Open in IMG/M |
| 3300026551|Ga0209648_10011247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7778 | Open in IMG/M |
| 3300026551|Ga0209648_10635818 | Not Available | 585 | Open in IMG/M |
| 3300026847|Ga0207802_1021181 | Not Available | 562 | Open in IMG/M |
| 3300027074|Ga0208092_100894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1526 | Open in IMG/M |
| 3300027076|Ga0208860_1016727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 719 | Open in IMG/M |
| 3300027094|Ga0208094_103725 | Not Available | 710 | Open in IMG/M |
| 3300027108|Ga0207946_107454 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300027297|Ga0208241_1043946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300027376|Ga0209004_1086846 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027583|Ga0209527_1009783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2024 | Open in IMG/M |
| 3300027603|Ga0209331_1019863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1741 | Open in IMG/M |
| 3300027610|Ga0209528_1003034 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3489 | Open in IMG/M |
| 3300027635|Ga0209625_1001997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4651 | Open in IMG/M |
| 3300027651|Ga0209217_1000414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 11591 | Open in IMG/M |
| 3300027680|Ga0207826_1193825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300027684|Ga0209626_1099624 | Not Available | 753 | Open in IMG/M |
| 3300027698|Ga0209446_1002403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4562 | Open in IMG/M |
| 3300027698|Ga0209446_1006678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2823 | Open in IMG/M |
| 3300027698|Ga0209446_1064973 | Not Available | 927 | Open in IMG/M |
| 3300027701|Ga0209447_10144503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300027727|Ga0209328_10048966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1298 | Open in IMG/M |
| 3300027737|Ga0209038_10023749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1807 | Open in IMG/M |
| 3300027783|Ga0209448_10212902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300027787|Ga0209074_10381414 | Not Available | 586 | Open in IMG/M |
| 3300027787|Ga0209074_10467839 | Not Available | 541 | Open in IMG/M |
| 3300027795|Ga0209139_10181820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300027812|Ga0209656_10261023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300027846|Ga0209180_10385355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300027874|Ga0209465_10054019 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
| 3300027874|Ga0209465_10183100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1044 | Open in IMG/M |
| 3300028536|Ga0137415_10732238 | Not Available | 800 | Open in IMG/M |
| 3300028906|Ga0308309_10051105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2979 | Open in IMG/M |
| 3300029701|Ga0222748_1087274 | Not Available | 590 | Open in IMG/M |
| 3300029701|Ga0222748_1128907 | Not Available | 516 | Open in IMG/M |
| 3300030967|Ga0075399_11233051 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300030967|Ga0075399_11470981 | Not Available | 559 | Open in IMG/M |
| 3300030969|Ga0075394_10003053 | Not Available | 510 | Open in IMG/M |
| 3300030969|Ga0075394_11696650 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300031057|Ga0170834_100010291 | Not Available | 1010 | Open in IMG/M |
| 3300031057|Ga0170834_102141608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2196 | Open in IMG/M |
| 3300031057|Ga0170834_107123403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1508 | Open in IMG/M |
| 3300031058|Ga0308189_10280200 | Not Available | 643 | Open in IMG/M |
| 3300031093|Ga0308197_10306112 | Not Available | 588 | Open in IMG/M |
| 3300031096|Ga0308193_1092300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300031122|Ga0170822_14523559 | Not Available | 719 | Open in IMG/M |
| 3300031231|Ga0170824_103702068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1421 | Open in IMG/M |
| 3300031231|Ga0170824_105707567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3254 | Open in IMG/M |
| 3300031231|Ga0170824_111059789 | Not Available | 542 | Open in IMG/M |
| 3300031231|Ga0170824_113135997 | Not Available | 649 | Open in IMG/M |
| 3300031231|Ga0170824_113523314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1657 | Open in IMG/M |
| 3300031231|Ga0170824_113862410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 969 | Open in IMG/M |
| 3300031231|Ga0170824_120906327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3591 | Open in IMG/M |
| 3300031231|Ga0170824_127955877 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031446|Ga0170820_12764550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1303 | Open in IMG/M |
| 3300031446|Ga0170820_13101313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1183 | Open in IMG/M |
| 3300031469|Ga0170819_10814770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300031469|Ga0170819_12564330 | Not Available | 552 | Open in IMG/M |
| 3300031469|Ga0170819_14009470 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031469|Ga0170819_16958656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2629 | Open in IMG/M |
| 3300031474|Ga0170818_101174531 | Not Available | 1764 | Open in IMG/M |
| 3300031474|Ga0170818_109366301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
| 3300031474|Ga0170818_112999419 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031543|Ga0318516_10000020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 28399 | Open in IMG/M |
| 3300031543|Ga0318516_10013715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3982 | Open in IMG/M |
| 3300031543|Ga0318516_10083665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1784 | Open in IMG/M |
| 3300031543|Ga0318516_10084505 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300031543|Ga0318516_10095178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1678 | Open in IMG/M |
| 3300031543|Ga0318516_10108533 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300031543|Ga0318516_10222324 | Not Available | 1092 | Open in IMG/M |
| 3300031543|Ga0318516_10236201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1057 | Open in IMG/M |
| 3300031543|Ga0318516_10265874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 992 | Open in IMG/M |
| 3300031543|Ga0318516_10320159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300031543|Ga0318516_10338371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 869 | Open in IMG/M |
| 3300031544|Ga0318534_10003592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 6996 | Open in IMG/M |
| 3300031544|Ga0318534_10523851 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031545|Ga0318541_10044724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2252 | Open in IMG/M |
| 3300031546|Ga0318538_10241563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 969 | Open in IMG/M |
| 3300031564|Ga0318573_10040958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2219 | Open in IMG/M |
| 3300031564|Ga0318573_10134844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1287 | Open in IMG/M |
| 3300031573|Ga0310915_10010962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 5259 | Open in IMG/M |
| 3300031573|Ga0310915_10581283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300031573|Ga0310915_11285023 | Not Available | 504 | Open in IMG/M |
| 3300031590|Ga0307483_1028649 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031590|Ga0307483_1029347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300031640|Ga0318555_10516743 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300031681|Ga0318572_10591876 | Not Available | 661 | Open in IMG/M |
| 3300031682|Ga0318560_10037837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2322 | Open in IMG/M |
| 3300031682|Ga0318560_10725578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300031719|Ga0306917_10100334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2075 | Open in IMG/M |
| 3300031719|Ga0306917_10303853 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300031719|Ga0306917_11019774 | Not Available | 646 | Open in IMG/M |
| 3300031720|Ga0307469_11180226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300031723|Ga0318493_10445158 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300031724|Ga0318500_10301304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300031740|Ga0307468_101571807 | Not Available | 613 | Open in IMG/M |
| 3300031744|Ga0306918_10146015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1742 | Open in IMG/M |
| 3300031747|Ga0318502_10562130 | Not Available | 685 | Open in IMG/M |
| 3300031748|Ga0318492_10499217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300031753|Ga0307477_10000925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 27507 | Open in IMG/M |
| 3300031753|Ga0307477_10230769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1284 | Open in IMG/M |
| 3300031753|Ga0307477_11045578 | Not Available | 534 | Open in IMG/M |
| 3300031754|Ga0307475_10211284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1552 | Open in IMG/M |
| 3300031763|Ga0318537_10204674 | Not Available | 734 | Open in IMG/M |
| 3300031768|Ga0318509_10392355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 776 | Open in IMG/M |
| 3300031768|Ga0318509_10710593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300031770|Ga0318521_10006095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4813 | Open in IMG/M |
| 3300031777|Ga0318543_10170952 | Not Available | 960 | Open in IMG/M |
| 3300031777|Ga0318543_10324848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300031778|Ga0318498_10385698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300031780|Ga0318508_1064092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 988 | Open in IMG/M |
| 3300031781|Ga0318547_10917528 | Not Available | 547 | Open in IMG/M |
| 3300031793|Ga0318548_10476965 | Not Available | 610 | Open in IMG/M |
| 3300031794|Ga0318503_10085846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 991 | Open in IMG/M |
| 3300031797|Ga0318550_10070068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1612 | Open in IMG/M |
| 3300031805|Ga0318497_10353536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300031805|Ga0318497_10658300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300031821|Ga0318567_10146757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1303 | Open in IMG/M |
| 3300031823|Ga0307478_10616908 | Not Available | 908 | Open in IMG/M |
| 3300031833|Ga0310917_10115371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1743 | Open in IMG/M |
| 3300031833|Ga0310917_10434346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 893 | Open in IMG/M |
| 3300031845|Ga0318511_10082819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1342 | Open in IMG/M |
| 3300031866|Ga0316049_115617 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300031879|Ga0306919_10082712 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
| 3300031879|Ga0306919_10114592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1920 | Open in IMG/M |
| 3300031890|Ga0306925_10601068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1162 | Open in IMG/M |
| 3300031890|Ga0306925_10781085 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300031894|Ga0318522_10399561 | Not Available | 521 | Open in IMG/M |
| 3300031910|Ga0306923_10336353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1723 | Open in IMG/M |
| 3300031910|Ga0306923_11086653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300031912|Ga0306921_10141412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2811 | Open in IMG/M |
| 3300031942|Ga0310916_10550858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 981 | Open in IMG/M |
| 3300031942|Ga0310916_11662138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300031946|Ga0310910_10078221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2404 | Open in IMG/M |
| 3300031946|Ga0310910_11143265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300031947|Ga0310909_10383580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1180 | Open in IMG/M |
| 3300031947|Ga0310909_10488471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
| 3300031954|Ga0306926_11170902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 905 | Open in IMG/M |
| 3300031959|Ga0318530_10427842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300032001|Ga0306922_10303736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1714 | Open in IMG/M |
| 3300032010|Ga0318569_10617828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300032025|Ga0318507_10353732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300032025|Ga0318507_10523365 | Not Available | 516 | Open in IMG/M |
| 3300032025|Ga0318507_10543113 | Not Available | 506 | Open in IMG/M |
| 3300032035|Ga0310911_10184572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
| 3300032035|Ga0310911_10290326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 940 | Open in IMG/M |
| 3300032041|Ga0318549_10018996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2569 | Open in IMG/M |
| 3300032051|Ga0318532_10316358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300032054|Ga0318570_10142806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1068 | Open in IMG/M |
| 3300032059|Ga0318533_10313759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1139 | Open in IMG/M |
| 3300032059|Ga0318533_10996506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300032160|Ga0311301_12356338 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300032180|Ga0307471_100519693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1341 | Open in IMG/M |
| 3300032180|Ga0307471_101207467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300032205|Ga0307472_100117693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1870 | Open in IMG/M |
| 3300032261|Ga0306920_100411325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2011 | Open in IMG/M |
| 3300032261|Ga0306920_100714942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1475 | Open in IMG/M |
| 3300032261|Ga0306920_100781475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1403 | Open in IMG/M |
| 3300032261|Ga0306920_101343384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300032261|Ga0306920_104288882 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300032515|Ga0348332_12081619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 998 | Open in IMG/M |
| 3300033289|Ga0310914_11807577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 515 | Open in IMG/M |
| 3300033290|Ga0318519_10559528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.58% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.31% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.09% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.65% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.44% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.44% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.44% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.22% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.22% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.22% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.22% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.22% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.22% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.22% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300001160 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027074 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027094 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF022 (SPAdes) | Environmental | Open in IMG/M |
| 3300027108 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF030 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031866 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_08626700 | 2189573004 | Grass Soil | RSAYLSRVVSGSARAETILALLLWSGVTVFIFGILIDLFR |
| JGI12654J13325_10036532 | 3300001160 | Forest Soil | MRMLRSADVYRIMPHSGRAHTILALLLWGGVTIFIFGIIVDVIR* |
| JGI12630J15595_101068732 | 3300001545 | Forest Soil | MSHAMRMLRTAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR* |
| JGI12627J18819_101254362 | 3300001867 | Forest Soil | MRMLRSAYLSRVVPDSARAQTLLAFLLWSGVTIFIFGILIDWFR* |
| JGI12627J18819_102921402 | 3300001867 | Forest Soil | MRMLRSAYVSRIMPDSARAHTILAVLLWGGVTIFIFGILVDVIR* |
| JGI25617J43924_100682992 | 3300002914 | Grasslands Soil | MRMLRSAYLSRVVPDSARAETILALLLWSGVTVFIFGILIDWFR* |
| JGI26339J46600_101423241 | 3300003218 | Bog Forest Soil | MRMLRSADVSRIMPDSARGHTILAILLWGGVTIFIFGILVDLIR* |
| JGI26341J46601_100002154 | 3300003219 | Bog Forest Soil | MRMLRSAYVSRIMSDSARGHTILAILLWGGVTIFIFGILVDVIR* |
| JGIcombinedJ51221_100381043 | 3300003505 | Forest Soil | MRMLRSAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR* |
| JGIcombinedJ51221_101204642 | 3300003505 | Forest Soil | MRMLRSTYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0062385_103043332 | 3300004080 | Bog Forest Soil | MRMLRSAYVSRMMPDSARGHTILAVLLWGGVTIFIFGILLDVIR* |
| Ga0062385_105838962 | 3300004080 | Bog Forest Soil | MRMLRSAYRSWVMPDSARAQNILALLLWSGVTVFIFGILIDLFR* |
| Ga0063454_1007891082 | 3300004081 | Soil | MSDAMRMLRSAYLSRVVPDSSRAQTILAFLLWSGVTVFIFGILMDLFR* |
| Ga0062387_1001783702 | 3300004091 | Bog Forest Soil | MRMLRSAYLSRVMPDSARAQTILALLLWSGVTIFIFGILIDLFP* |
| Ga0062386_1000073764 | 3300004152 | Bog Forest Soil | MHMLWSAYLSRMVPDSARTQTILALLLWSGVTVFIFGIIIDFFR* |
| Ga0062386_1003509242 | 3300004152 | Bog Forest Soil | MGMLRSAYLSRMMPDSARAHTIFALLLWSGVTIFIFGILVDLIR* |
| Ga0062386_1005398622 | 3300004152 | Bog Forest Soil | MPMLRSAYLSRVMADPARVHSILALLLWSGVTIFIFGILIDLIR* |
| Ga0062386_1014106352 | 3300004152 | Bog Forest Soil | MAMLRSAYLSRMMPDSARAHTIFAALLWSGATIFIFAILAD |
| Ga0066395_101259302 | 3300004633 | Tropical Forest Soil | MRTLRSACLSRIMPNAPRGNTILALLLWSGVTVFIFSIIIDLFR* |
| Ga0066395_102075342 | 3300004633 | Tropical Forest Soil | MRMLRSAELYRMVPRPPRAQTVLAFLLWSGVTVFIFGIIIDLFR* |
| Ga0066395_102445981 | 3300004633 | Tropical Forest Soil | MRMLRSADLYRMVPSPPRADTVLAFLLWSGVTVFIFGIIIDLFR* |
| Ga0066672_107283842 | 3300005167 | Soil | MRMLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0066677_101426032 | 3300005171 | Soil | MRMLRSAYLSRIVPDSARAQTILALLLWSGVTVFIFGILIDVVR* |
| Ga0066677_102118412 | 3300005171 | Soil | MRILRSAYISRFMLDSERGRTILALLLWGGVTIFVFGILVDVIR* |
| Ga0066679_109129482 | 3300005176 | Soil | SCWMSDAMRMLRSAYFSRVVPDAARAQTILALLLWSGVTVFIFGILIDWFR* |
| Ga0066690_100444232 | 3300005177 | Soil | MRILRSAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR* |
| Ga0066678_108117122 | 3300005181 | Soil | MHMLRSAYLSRMVPDSARTQTILALLLWSGVTVFIFGIIIDFFR* |
| Ga0066671_106809572 | 3300005184 | Soil | MSDAMRMLRSAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDVVR* |
| Ga0066388_1000488811 | 3300005332 | Tropical Forest Soil | MRMLRSADLYRMVPSPPPADTVLAFLLWSGVTVFIFGIIIDLFR* |
| Ga0066388_1004591333 | 3300005332 | Tropical Forest Soil | DRRWWRSYAMRILRSAYLNRMMPGPARADTVLALLLWSGVTVFIFGIVIDLFR* |
| Ga0066388_1010046042 | 3300005332 | Tropical Forest Soil | MRMLRSAYVSRMMPDSARAHTILAVLLWGGVTIFIFGILVDVIR* |
| Ga0066388_1017603472 | 3300005332 | Tropical Forest Soil | MRVLRSAYVSRIMPDRARADTILALLLWSAVTIFVFGILVDLIH* |
| Ga0066388_1017966981 | 3300005332 | Tropical Forest Soil | RMLRLADVYRMMPDSARAHTILAVLLWGGVTLFVFGIITDLIR* |
| Ga0066388_1029749972 | 3300005332 | Tropical Forest Soil | MRMLRSAYVSRIMPDPARVHTILAVLLWVGVTIFIFGIVVDLIH* |
| Ga0066388_1032692271 | 3300005332 | Tropical Forest Soil | MSPAMRIKRSAYFSRVIPDSGRAQTIFALLLWSGVTIFIFGILIDFFR* |
| Ga0066388_1035088472 | 3300005332 | Tropical Forest Soil | MRTLRSACLSRIMPNAPRGNIILALLLWSGVTVFIFGIIIDLFR* |
| Ga0066388_1040964672 | 3300005332 | Tropical Forest Soil | MRVLRSAQFYRMVPSSARAQTILGFLLWSGVTIFIFGIIIDLFR* |
| Ga0066388_1049616761 | 3300005332 | Tropical Forest Soil | MRMLRSADISRIMPDSGQRDTILAVLLWGGVTIFIFGILLDLIR* |
| Ga0066388_1066580431 | 3300005332 | Tropical Forest Soil | MRMLRLADVYRIMPDSARGYTILAALLWGGVTLFVFAIIADLIR* |
| Ga0066388_1069706491 | 3300005332 | Tropical Forest Soil | VLRSSYVSRMMPDSVRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0066388_1070882702 | 3300005332 | Tropical Forest Soil | MPMRRSAYLSRIAPGSARAQTLLAFALWSGVTVFIFGILIDFFR* |
| Ga0008090_150755501 | 3300005363 | Tropical Rainforest Soil | MRTLRSACLSRIMPNAPRGNTLLALVLWSGVTVFIFGIIIDLFR* |
| Ga0070709_100137425 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMLRSAYLSRVVPDSARAETIFAFLLWSGVIVFIFGILTDFFR* |
| Ga0070709_105530952 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMLRSAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDFFR* |
| Ga0070714_1018536651 | 3300005435 | Agricultural Soil | MSDAMRMLRSAYLSRVVPDSSRAQTVLAFLLWSGVTVFIFGILIDLFR* |
| Ga0070713_1000340302 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMLRLAYLSRVMPDSSRAQTVLAFLLWSGVTVFIFGILMDLFR* |
| Ga0070713_1008446362 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIKRSGYLSRVLPGAAHAQTILALLLWSGVTIFIFGILIDFFR* |
| Ga0070713_1012237672 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMLRSAYLYRMVPDSARAHTILALLLWSGVTVFIFGILIDLFR* |
| Ga0070710_107989172 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDAMRMLRSAYLSRVVPDSSRAQTILAFLLWSGVTIFIFGILMDLFR* |
| Ga0070711_1018172242 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMLRSAYLYRMVPGSARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0070708_1016700162 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMLRSAYLYRMMPDSARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0070699_1002060521 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMLRSAYVYRIMPDSGRAHTILAILLWGGVTIFIFGILVDVIR* |
| Ga0070699_1020944431 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0066704_107771292 | 3300005557 | Soil | MRMLRSAYVYRIMPDSGRAHTILALLLWGGVTIFI |
| Ga0066700_102414781 | 3300005559 | Soil | MRMLRFAYVSRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0066708_100230983 | 3300005576 | Soil | MSDEMRILRSAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR* |
| Ga0066706_104335272 | 3300005598 | Soil | MRMLRSGYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0070762_103183332 | 3300005602 | Soil | MSDAMRMLRSAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR* |
| Ga0066903_1001618252 | 3300005764 | Tropical Forest Soil | MRILRSAYLNRMMPGPARADTVLALLLWSGVTVFIFGIVIDLFR* |
| Ga0066903_1002856643 | 3300005764 | Tropical Forest Soil | MRASDTMPMKRSPYLWRSLLGGTQPQTILALLLWSGVTVFIFGILIDFFR* |
| Ga0066903_1003277872 | 3300005764 | Tropical Forest Soil | MRMLRSADLYGMVPSSARAQTILALLLWGGVTAFIFGIVIDLFH* |
| Ga0066903_1003278752 | 3300005764 | Tropical Forest Soil | MPRSAYLARIAPGSARTQTILAFVLWSGVTVFIFGILIDFFR* |
| Ga0066903_1009473252 | 3300005764 | Tropical Forest Soil | MRMLRLADVYRMMPDSARAHTILAVLLWGGVTLFVFGIITDLIH* |
| Ga0066903_1023532912 | 3300005764 | Tropical Forest Soil | MRLLRLADVYRIMPDPARGYTILAALLWGGVILFIFAIITDLIR* |
| Ga0066903_1025558452 | 3300005764 | Tropical Forest Soil | MRVLRSAYVSRIMPDRARADTILALLLWGAVTIFVFGILVDLIH* |
| Ga0066903_1053740052 | 3300005764 | Tropical Forest Soil | ARQLKLTRYVVRSDAMRMLRSADLYRMVPSPPRAQTVLAFLLWSGVTVFIFGIIIDLFR* |
| Ga0066903_1057036772 | 3300005764 | Tropical Forest Soil | MRMLRSASLSRMMPDSARAHMIFALLLWSGVTIFIFGILVDLIR* |
| Ga0066903_1057858162 | 3300005764 | Tropical Forest Soil | MRTLRPACLSRIMPNAPRGNTVFALLLWSGVTVFIFGIIIDLFR* |
| Ga0070766_102412502 | 3300005921 | Soil | LTASCWMSDAMRMLRSAYLSRVVPDSARAQTIFALLLWSGVTVFIFGILIDLFR* |
| Ga0081540_100332611 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MRMLRAAHLYRTVSGSPRAHTALALLLWTGVTVFIFGILVDFFR* |
| Ga0070717_1000209710 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMLRSADLYGMVPSSARAHTILAFLLWGGVTAFIFGIVIDLFH* |
| Ga0070717_105183612 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PPSCWMSDAMRMLRSAYLSRVVPDSSRAQTVLAFLLWSGVTVFIFGILMDLFR* |
| Ga0066652_1006841602 | 3300006046 | Soil | MSDAMRMLRSAYLSRVVPDSARAQTILALLLWSGVTIFIFGILIDLFR* |
| Ga0070712_1000419165 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMLRTAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR* |
| Ga0070712_1014021632 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMLRSAYLYRMVPDSARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0070765_1001100181 | 3300006176 | Soil | MRMLRSAYLSRVVPDSARAQTIFALLLWSGVTVFIFGILIDLFR* |
| Ga0079222_111788722 | 3300006755 | Agricultural Soil | MSDAMRMLWSAYLSRIVPDSARAETILALLLWSGVTVFIFGILIDVVR* |
| Ga0079222_118669831 | 3300006755 | Agricultural Soil | MDEAMPMPRSAYLARIAPARAQTIVAFVLWSGVTVFIFGILTDFFR* |
| Ga0079221_117066751 | 3300006804 | Agricultural Soil | MRMLRSAYLSRVIPDSARAQTILALLLWSGVTVFIFGILIDLFR* |
| Ga0075434_1001415613 | 3300006871 | Populus Rhizosphere | MRMLRSAYLYRMMPESARAETVLALVLWSGVTVFILGILTDFFR* |
| Ga0079219_119336151 | 3300006954 | Agricultural Soil | MSDAMRMLRSAYLSRVLPDSARAETILALLLWSGVTVFIFGILIDWFR* |
| Ga0099791_101651071 | 3300007255 | Vadose Zone Soil | MLRLAYVSRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0099791_101896303 | 3300007255 | Vadose Zone Soil | SAYLYRMMPDSARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0099793_100962072 | 3300007258 | Vadose Zone Soil | MLRSAYLYRMMPDSARAHTILALLLWSGVTIFIFGILIDLFH* |
| Ga0099793_101111421 | 3300007258 | Vadose Zone Soil | MLRSAYVSRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0099795_101340572 | 3300007788 | Vadose Zone Soil | MLRSAYLYRMVPDSARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0066710_1010041612 | 3300009012 | Grasslands Soil | MSDAMRMLRSAYLSRIVPDSARAQTILALLLWSGVTVFIFGILIDVVR |
| Ga0066710_1016660341 | 3300009012 | Grasslands Soil | MRMLRSSYVSRIMPGSARADTILALLLWGGVTIFIFGILLDVIR |
| Ga0066710_1039178302 | 3300009012 | Grasslands Soil | MRMLRPAYLSRMMPDSARAQMIFALLLWSGVTIFIFGIPVDLIR |
| Ga0099829_100046224 | 3300009038 | Vadose Zone Soil | MLRSAYFTRIMPGSARADTILALLLWGGVTIFIFGILVDVIR* |
| Ga0099829_102089282 | 3300009038 | Vadose Zone Soil | MLRSAYLYRMMPDSARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0099829_105185812 | 3300009038 | Vadose Zone Soil | MRVLRSAYLYRMVPDSARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0099827_108249812 | 3300009090 | Vadose Zone Soil | MLRSAYVSRIMPDSGRAHTILAILLWGGVTIFIFGILVDVIH* |
| Ga0099827_120066801 | 3300009090 | Vadose Zone Soil | MLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGIL |
| Ga0105245_118557422 | 3300009098 | Miscanthus Rhizosphere | MLRSAYLYRMMPESARAETVLALVLWSGVTVFILGILTDFFR* |
| Ga0066709_1007062331 | 3300009137 | Grasslands Soil | MLRSAYVYRIMPDSGRAHTILALLPWGGVTIFIFGILVDVIR* |
| Ga0099792_106003613 | 3300009143 | Vadose Zone Soil | MLRSAYVSRIMPDSGRAHTILALLLWGGVTIFIFGILIDVIR* |
| Ga0126374_100725523 | 3300009792 | Tropical Forest Soil | MRTLRSACLSRIMPNAPRGNTLLALLLWSGVTVFIFGIIIDLFR* |
| Ga0126374_101944941 | 3300009792 | Tropical Forest Soil | MLRSAYVSRIMPDSGRARTIFALLLWGGVTIFIFGILVDVIR* |
| Ga0126374_112834541 | 3300009792 | Tropical Forest Soil | MLRSADISRIMPDSGQRDTILAVLLWGGVTIFIFGILLDLIR* |
| Ga0126380_103409932 | 3300010043 | Tropical Forest Soil | MLRWAYVYRIMPDSGRAHTILALLLWGGVTVFIFGILVDVIR* |
| Ga0126384_100102263 | 3300010046 | Tropical Forest Soil | MSPAMRTKRSAYFSRVIPDSGRAQTIFALLLWSGVTIFIFGILIDFFR* |
| Ga0126384_108638871 | 3300010046 | Tropical Forest Soil | ADLYRMVPGPPRAQTILAFLLWSGVTVFIFGIIIDLFR* |
| Ga0126373_100501535 | 3300010048 | Tropical Forest Soil | MPMKRSPYLWRSLLGGTQPQTILALLLWSGVTVFIFGILIDFFR* |
| Ga0126373_102057802 | 3300010048 | Tropical Forest Soil | MLRSAYVSRIMPDSLRWDTIFAVLLWGGVTIFIFGIVVDLIH* |
| Ga0126373_107132622 | 3300010048 | Tropical Forest Soil | MRVLRSAYLSRIVPHGMRGEAILALLLWSGVTVFIFGIIIDFFR* |
| Ga0126373_120749802 | 3300010048 | Tropical Forest Soil | MLRSAYVSRIMPDPARVHTILAVLLWVGVTIFIFGIVVDLIH* |
| Ga0126373_121508162 | 3300010048 | Tropical Forest Soil | MLRSAYVSRIMPDPARVHTILAVLLWGGVTIFIFGILLDVIR* |
| Ga0126373_126695222 | 3300010048 | Tropical Forest Soil | MRMLRLADVYRMMPDAARGYTILAALLWGGVTLFVFAIIADLIR* |
| Ga0126373_128880481 | 3300010048 | Tropical Forest Soil | MRMLRLADVHRMMPDSARAHTILAVLLWGGVTLFVFGIITDLIH* |
| Ga0126318_101736931 | 3300010152 | Soil | MSDAMRMLRSAYLSRVVPGSARAETILALLLWSGVTIFIFGILIDLFR* |
| Ga0127503_103889572 | 3300010154 | Soil | MLRSAYITRIMPGSARADTILALLLWGGVTIFIFGILVDVIR* |
| Ga0127503_104145221 | 3300010154 | Soil | RSGAMRMLRSAYVSRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0127503_113021651 | 3300010154 | Soil | GAMRMLRSAYLYRMMPDSARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0131853_102386043 | 3300010162 | Termite Gut | MRMPRSAYLSRIMPHPARGSAILALLLWSGVTIFIFGIIIDFFR* |
| Ga0131853_107559182 | 3300010162 | Termite Gut | MRVLRSAYLSRIVPRGMRGEAILALLLWSGVTVFIFGIIIDFFR* |
| Ga0074046_100489542 | 3300010339 | Bog Forest Soil | MLRSADVSRIMPDSARGHTILAILLWGGVTIFIFGILVDLIR* |
| Ga0074045_101872262 | 3300010341 | Bog Forest Soil | MLRSAYLSRVMADPARVHSILVLLLWSGVTIFIFGILIDLIR* |
| Ga0074044_107855921 | 3300010343 | Bog Forest Soil | AMRMLRSADVSRIMPDSARGHTILAILLWGGVTIFIFGILVDLIR* |
| Ga0126370_105807542 | 3300010358 | Tropical Forest Soil | MRMLRLADVYRMMPDSARAHTILAVLLWGGVTLFVFGIITDLIR* |
| Ga0126376_106817592 | 3300010359 | Tropical Forest Soil | ACLSRIMPNAPRGNTVLALLLWSGVTVFIFGIIIDLFR* |
| Ga0126372_100780012 | 3300010360 | Tropical Forest Soil | MRILRSAYLNRMMPGTARADTVLALLLWSGVTVFIFGIVIDLFR* |
| Ga0126372_103955542 | 3300010360 | Tropical Forest Soil | MRTLRPACLSRIMPNAPRGNTILALLLWSGVTVFIFGIIIDLFR* |
| Ga0126372_130288301 | 3300010360 | Tropical Forest Soil | MLRSADVFRIMPDSGRARTIFALLLWGGVTIFIFGILVDVIR* |
| Ga0126378_100913223 | 3300010361 | Tropical Forest Soil | MLRSAYVSRIMPDSARAHTILAFLLWGWVTIFIFGIVVDVIR* |
| Ga0126378_101443581 | 3300010361 | Tropical Forest Soil | RWRSVAMRMLRLADVYRMMPDSARAHTILAVLLWGGVTLFVFGIITDLIR* |
| Ga0126378_102662002 | 3300010361 | Tropical Forest Soil | MRTLRSACLSRIMPNAPRGNTILALLLWSGVTVFIFGIIIDLFR* |
| Ga0126378_106956271 | 3300010361 | Tropical Forest Soil | MLRSAELYRMVPRPPRAQTVLAFLLWSGVTVFIFGIIIDL |
| Ga0126378_108775032 | 3300010361 | Tropical Forest Soil | MRTLRWACLSRILPNAPRGNTLLALLLWSGVTVFIFGIIIDLFR* |
| Ga0126378_117102901 | 3300010361 | Tropical Forest Soil | LKLTRYVVRSDAMRMLRSADLYRMVPSPPRAQTILAFLLWSGVTVFIFGIIIDLFR* |
| Ga0126377_125116212 | 3300010362 | Tropical Forest Soil | MLRSADVYRIMPDSGRARTIFAILLWGGVTVFIFGILVDVIR* |
| Ga0126379_100467355 | 3300010366 | Tropical Forest Soil | MRMLRSADLYRMVPSPPRAQTVLAFLLWSGVTVFIFGIIIDLFR* |
| Ga0126379_136144972 | 3300010366 | Tropical Forest Soil | MLRSADVSRIMPDAGRARTIFALLLWGGVTIFIFGILVDVIR* |
| Ga0126381_1000994723 | 3300010376 | Tropical Forest Soil | MNDAMPMRRSAYLSRIAPGSARAQILLAFALWSGVTVFIFGILIDFFR* |
| Ga0126381_1001427932 | 3300010376 | Tropical Forest Soil | MSDAMRMLRSAYLSSMAPGSARAQNILALLLWSGVTVFIFGILIDFFR* |
| Ga0126381_1001960282 | 3300010376 | Tropical Forest Soil | MLRSAYVSRIMPDSGRARTIFAILLWGGVTVFIFGILVDVIR* |
| Ga0126381_1001994142 | 3300010376 | Tropical Forest Soil | MLGSSYVSRIMPDSLQMGTVIALLMWGGVTIFIFGILVDLIR* |
| Ga0126381_1007497912 | 3300010376 | Tropical Forest Soil | MRPLHSANVSRIMPDSLCWNTIVAVLLWGVVASFIFGILVDLIR* |
| Ga0126381_1011793953 | 3300010376 | Tropical Forest Soil | SRIMPDRARADTILALLLWSAVTIFVFGILVDLIH* |
| Ga0126381_1017485712 | 3300010376 | Tropical Forest Soil | MLRSAYVSRIMPDPARVHTILAFLLWGGVTIFIFGILLDVIR* |
| Ga0126381_1028045352 | 3300010376 | Tropical Forest Soil | MLRSAYVSRIMLDSLRWDTIFAVLLWGGVTIFIFGIVVDLIH* |
| Ga0136449_1034566282 | 3300010379 | Peatlands Soil | MLRSAYLSRMMPDSARAHRVFALLLWSGVTIFIFGILVDLIR* |
| Ga0126383_107067982 | 3300010398 | Tropical Forest Soil | MRTLRSACLSRIMPNAPRGYTLLALLLWSGVTVFIFGIIIDLFR* |
| Ga0126383_109468793 | 3300010398 | Tropical Forest Soil | SRIMPDSLCWNTIVAVLLWGVVASFIFGILVDLIR* |
| Ga0124850_10217412 | 3300010863 | Tropical Forest Soil | MRMLRSADLYRMVPSPPRAQTILAFLLWSGVTVFIFGIIIDLFR* |
| Ga0150983_114354811 | 3300011120 | Forest Soil | RWRSGAMRMLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0150983_117246581 | 3300011120 | Forest Soil | MLRTAYVSRIMPDSVRGHTILAVLLWGGVTIFIFGILVDVIR* |
| Ga0150983_141955041 | 3300011120 | Forest Soil | MLRSAYVSRIMPDSARAHTILAVLLWGGVTIFIFGILVDVIR* |
| Ga0150983_149154281 | 3300011120 | Forest Soil | MRMLRSANVSRIMPDSLRWDTIVAALLWGVVTIFIFGILVDLIR* |
| Ga0150983_153736922 | 3300011120 | Forest Soil | MLRSAYLTRIMPGSARADTILALLLWGGVTIFIFGILVDVIR* |
| Ga0137391_113494092 | 3300011270 | Vadose Zone Soil | MLRSSYVSRIMPDSVRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0137393_101277054 | 3300011271 | Vadose Zone Soil | RSAYFTRIMPGSARADTILALLLWGGVTIFIFGILVDVIR* |
| Ga0137393_102513832 | 3300011271 | Vadose Zone Soil | MRMLRSAYLYRMVPDTARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0137382_109518772 | 3300012200 | Vadose Zone Soil | MSDAMRMLRSAYLSRVLPDSARAQTILALLLWSGVTVFIFGILIDWFR* |
| Ga0137382_109544782 | 3300012200 | Vadose Zone Soil | MLRSSYVSRIMPGSARADTILALLLWGGVTIFIFGILVDVIR* |
| Ga0137363_110493752 | 3300012202 | Vadose Zone Soil | MGWSDAMRVLRSAYLYRMVPDSARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0137362_103877041 | 3300012205 | Vadose Zone Soil | MRMRRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0137362_112988362 | 3300012205 | Vadose Zone Soil | MRMRRSAYVCRIMRASGRAHTILALLWWGGVTIFIFGILVDVIR* |
| Ga0137376_111950692 | 3300012208 | Vadose Zone Soil | MSDAMRMLRSAYFSRVVPDAARAQTILALLLWSGVTVFIFGILIDWFR* |
| Ga0137377_102422793 | 3300012211 | Vadose Zone Soil | MRMLRSADLYRMVPDWARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0150985_1008170882 | 3300012212 | Avena Fatua Rhizosphere | MLRSAYLYRMMPESARAEIVLALVLWSGVTVFILGILTDFFR* |
| Ga0137366_111727372 | 3300012354 | Vadose Zone Soil | MRMLRSAYLYRLVPDSARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0137360_105466483 | 3300012361 | Vadose Zone Soil | RSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0137360_113079722 | 3300012361 | Vadose Zone Soil | MRMLRSAHFYRMMPDSARAHTILALLLWSGVTVFIFGILIDLFH* |
| Ga0137361_100402715 | 3300012362 | Vadose Zone Soil | MLRSAYVSRIMPDSGRAHTILALLLWGGVTIFIFGILIDLIR* |
| Ga0137361_101094973 | 3300012362 | Vadose Zone Soil | MRRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0137361_105159263 | 3300012362 | Vadose Zone Soil | GAMRMLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0150984_1013289722 | 3300012469 | Avena Fatua Rhizosphere | MLRSAYLYRMMPESARAEIVFALVLWSGVTVFIVGILTDCFR* |
| Ga0150984_1209786332 | 3300012469 | Avena Fatua Rhizosphere | MRMLRSAYLSRVVPDSSRAQTILAFLLWSGVTVFIFGILMDLFR* |
| Ga0137395_107145702 | 3300012917 | Vadose Zone Soil | MRMLRSAYFTRIMPGSARADTILALLLWGGVTIFIFGILVDVIR* |
| Ga0137416_104958283 | 3300012927 | Vadose Zone Soil | WRSGAMRMLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR* |
| Ga0137404_118571682 | 3300012929 | Vadose Zone Soil | MLRSAYVSRIMPDSGRAQTILAILLWGGVTIFIFGILVDVIR* |
| Ga0126375_107327891 | 3300012948 | Tropical Forest Soil | MRMLRSAYISRIMPYSLPGDTILAVLLWGGVTIFIFGILLDLIR* |
| Ga0126369_115952722 | 3300012971 | Tropical Forest Soil | MRTLRSACLSRIMPNAPRGYTLFALLLWSGVTVFIFGIIIDLFR* |
| Ga0126369_118088082 | 3300012971 | Tropical Forest Soil | MLRSADLYGMVPSSARAQTILALLLWGGVTAFIFGIVIDLFH* |
| Ga0137409_103189712 | 3300015245 | Vadose Zone Soil | MLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILIDVIR* |
| Ga0182036_100926681 | 3300016270 | Soil | AYVSRIMPDSARAHTILAFLLWGGVTIFIFGILFDVIR |
| Ga0182036_102686041 | 3300016270 | Soil | MRMLGSARLSRIMPDSVRAHTILAVLLWGGVTIFIFGI |
| Ga0182036_109002721 | 3300016270 | Soil | MRMLRSAFLYRMVSGSAGVHTILALLLWSGVTVFIFG |
| Ga0182041_102109953 | 3300016294 | Soil | MLRSAYVSRIMLDSLRWDTIFAVLLWGGVTIFIFGIVVDLIH |
| Ga0182041_105596181 | 3300016294 | Soil | MRMLRLADVYRMMPDSARAHTILAVLLWGGVTLFVFVIITDLIR |
| Ga0182041_109270231 | 3300016294 | Soil | MRMLRSAYLSRVVPDSARAQTLLAFLLWSGVTVFIFGILID |
| Ga0182041_114323532 | 3300016294 | Soil | SRMMPDSGRAHTILAVLLWGGVTLFIFGILVDVIR |
| Ga0182033_104317362 | 3300016319 | Soil | MRMLRLADVYRMMPDSARGHTILAVLLWGGVTLFVFGIITDLIR |
| Ga0182033_119031661 | 3300016319 | Soil | MLRSADLYRMVPDAGRAHTVLAFLLWSGVTIFIFGIIIDLFR |
| Ga0182035_100628443 | 3300016341 | Soil | MRMLRLADVYRMMPDSARAHTILAVLLWGGVTLFVFGIITDVIH |
| Ga0182035_101018391 | 3300016341 | Soil | YLSRMVPDSARGHTILALLLWSGVTIFIFGILIDLIH |
| Ga0182035_103684452 | 3300016341 | Soil | MLRSAYVSRIISDSLRRDTIFAVLLWGGVTIFIFGIVVDLIH |
| Ga0182035_109283662 | 3300016341 | Soil | SDAMRMLRSAYLSRVVPDSARAQTLLAFLLWSGVTVFIFGILIDWFR |
| Ga0182032_105613862 | 3300016357 | Soil | MRMLRSAYFSRIMPDSLRWDTIFAVLLWGGVTIFIFGIVVDLIH |
| Ga0182032_119828461 | 3300016357 | Soil | MRMLRSAYLSRVVPDSARAQTLLAFLLWSGVTVFIFGILIDW |
| Ga0182040_113673442 | 3300016387 | Soil | MRMLRSAYVSRIMLDSLRWDTIFAVLLWGGVTIFIFGIVVDLIH |
| Ga0182040_118249002 | 3300016387 | Soil | LRSAYVSRIMPDSARAHTILAFLLWGGVTIFIFGIVVDVIR |
| Ga0182037_100072632 | 3300016404 | Soil | MRMLRSADLYGMVPSSARAQTILALLLWGGVTAFSVVIVIDLFH |
| Ga0182037_112766192 | 3300016404 | Soil | MRMLRSAYGSRIMPDSARAHTILAFLLWGGVTIFIFGILLDVIR |
| Ga0182037_116787561 | 3300016404 | Soil | MRMLRSAYLSRMVPDSARGHTILALLLWSGVTIFIFG |
| Ga0182039_114564022 | 3300016422 | Soil | SAYVSRIMLDSLRWDTIFAVLLWGGVTIFIFGIVVDLIH |
| Ga0182038_106850512 | 3300016445 | Soil | WMSDAMRMLRSADLSRVVPDSARTQTLLAFLLWSGVTVFIFGILIDWFR |
| Ga0182038_106901512 | 3300016445 | Soil | MRMLRSAYVSRIMPDSLRWDTIFAVLLWGGVTIFIFGIVVDLIH |
| Ga0187802_101750422 | 3300017822 | Freshwater Sediment | MRMLRSAYVSRIIADPARGHTILAILLWGGVTIFIFGILVDLIR |
| Ga0187819_100437422 | 3300017943 | Freshwater Sediment | MRMLRSAYVSRIIADPVRGHTILAILLWGGVTIFIFGILVDLIR |
| Ga0187783_103533502 | 3300017970 | Tropical Peatland | MRTLRSAYLARMMPDTARRQMILTLLLWTGVTVFIFGILIDLFR |
| Ga0187783_105676692 | 3300017970 | Tropical Peatland | MRMLRLADVYRIMPDSARGYTILAALLWGGVILFIFGIIVDLIR |
| Ga0187783_108747162 | 3300017970 | Tropical Peatland | MRMLRLADVYRMMPDSARAHTILAVLLWGGVTLFVFGIITDLIR |
| Ga0187777_105558252 | 3300017974 | Tropical Peatland | MRMLRLAYVYRMMPDSARAHTILAALLWGGVTLFVFGIITDLIR |
| Ga0187782_106947002 | 3300017975 | Tropical Peatland | MRMLRLADVYRMMPDSARAHTILALLLWGGVTLFVFGIITDLIR |
| Ga0187804_103485412 | 3300018006 | Freshwater Sediment | MRMPRSAYVSRIIADPVRGHTILATLLWGGVTIFIFGILVDLIR |
| Ga0187769_100924912 | 3300018086 | Tropical Peatland | MRMLRSAYVSRIISDPVRGHTILAILLWGGVTIFIFGILVDLIR |
| Ga0066669_103755861 | 3300018482 | Grasslands Soil | MSDAMRMLRSAYLSRVVPDSARAQTILALLLWSGVTIFIFGILIDLFR |
| Ga0066669_109564532 | 3300018482 | Grasslands Soil | MRMLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0210407_1000076232 | 3300020579 | Soil | MRMLRSTYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0210407_100175274 | 3300020579 | Soil | MRMLRSANVSRIMPDSLRWDTIVAALLWGVVTIFIFGILVDLIR |
| Ga0210403_101786733 | 3300020580 | Soil | YVYRIMPGSGRAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0210403_103452852 | 3300020580 | Soil | MRMLRSAYLTRIMPGSARADTILALLLWGGVTIFIFGILVDVIR |
| Ga0210403_108920241 | 3300020580 | Soil | MSDAMRMLRSAYLSGVVPDSARAQTLLAFLLWSGVTVFIFGILIDWFR |
| Ga0210395_103585821 | 3300020582 | Soil | MRMLRSAYFSRVAPDSARVQTILALLLWSGVTVFIFGIL |
| Ga0179596_107246102 | 3300021086 | Vadose Zone Soil | MRMLRSAYFTRIMPGSARADTILALLLWGGVTIFIFGILVDVIR |
| Ga0210404_100746422 | 3300021088 | Soil | MSDAMRMLRSAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR |
| Ga0210406_104375282 | 3300021168 | Soil | MSDAMRMLRSAYLSGVVPDSARAQTLLAFLLWSGVTVFIFGILMDLFR |
| Ga0210405_104739822 | 3300021171 | Soil | MRMLRSTYVYRIMPGSGRAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0210405_104956812 | 3300021171 | Soil | MRMLRSAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR |
| Ga0210405_111258072 | 3300021171 | Soil | SAALSRVVPDSARAQTILALLLWSGVTVFIFGILIDWFR |
| Ga0210408_102181263 | 3300021178 | Soil | MRMLRSASLYRIVPDSARAHTILALLLWSGVTVFIFGILIDLFH |
| Ga0210396_106011442 | 3300021180 | Soil | MRMLRSAYLSRVVPDSGRVQTILALLLWSGVTVFIFGILIDLVH |
| Ga0213873_100593381 | 3300021358 | Rhizosphere | MRVLRSAYLSRIMPHRTRGDAILALLLWSGVTVFIFGIIIDFFR |
| Ga0213873_102273012 | 3300021358 | Rhizosphere | MRMLRLADVRRIMPDPARGHMILAILLWGGVTIFVFGIIADVIR |
| Ga0213873_103044492 | 3300021358 | Rhizosphere | AMRMLRSAYLSRVVPDSARAQTILAFLLWSGVTVFIFGILIDLFR |
| Ga0213872_102454382 | 3300021361 | Rhizosphere | MRMLQLANLRRIMPDPARGHMILAIRLWGGVTIFVFGIIADVIR |
| Ga0213872_102722122 | 3300021361 | Rhizosphere | MRMLQLADLRRIMPDPPRGHTILAILLWGGVTIFVFGIIADVIR |
| Ga0213882_101003662 | 3300021362 | Exposed Rock | MSDAMRMLRSAYLSRVVPDSARAQTILAFLLWSGVTVFIFGILIDLFR |
| Ga0213882_103756981 | 3300021362 | Exposed Rock | MAMRRSAYLLRIAPGSARAETILAFALWSGVTVFIFGILIDFFR |
| Ga0213881_100034512 | 3300021374 | Exposed Rock | MRRSAYLARIAPGSARAQTILAFALWSGVTVFIFGILIDFFR |
| Ga0213874_100133772 | 3300021377 | Plant Roots | MRMLRSAYLSRVVPDSARAQTILAFLLWSGVTVFIFGILIDLFR |
| Ga0213876_104927402 | 3300021384 | Plant Roots | MLRSAYLSRVVPGPARAETILALVLWSGVTVFIFGILIDWFR |
| Ga0210389_102467292 | 3300021404 | Soil | MSDAMRMLRSAYLSRVVPDSARVQTILALLLWSGVTVFIFGILIDLVH |
| Ga0210389_103073793 | 3300021404 | Soil | MSDAMRMLRSAYLSRVVPDSARAQTLLAFLLWSGVTVFIFSILIDWFR |
| Ga0210387_102495942 | 3300021405 | Soil | MRMLRSAYLSRVVPDSARVQTILALLLWSGVTVFIFGILIDLVH |
| Ga0210387_115640561 | 3300021405 | Soil | MSDAMRMLRSAYFSRVAPDSARVQTILALLLWSGVTVFIFGILIDWFR |
| Ga0210394_111333552 | 3300021420 | Soil | MRKLRPASVLRIMPDAARLETILAILLWGGVTIFIFGILIDVIR |
| Ga0210384_114624502 | 3300021432 | Soil | MRMLQSAYISRIMPDSGRRDTILAVLLWGAVTIFIFGILLDLIR |
| Ga0213879_100063003 | 3300021439 | Bulk Soil | MRVLRSAYLSRILPHRTRGDAILALLLWSGVTVFIFGIIINFFR |
| Ga0213879_100454823 | 3300021439 | Bulk Soil | MRMLRLADVRRIMPDPARGHMILAILLWGGVTIFIFGIIADVIR |
| Ga0213879_100823292 | 3300021439 | Bulk Soil | MRMLQLANLRRIMPDPARGHMILAILLWGGVTIFVFGIIADVIR |
| Ga0213879_100837962 | 3300021439 | Bulk Soil | MRMLRLADVYRIMPDSARGYTILAALLWGGVTLFVFAIITDLIH |
| Ga0213871_100897242 | 3300021441 | Rhizosphere | MSDAMRVLRSAYLSRVVPDSARAQTILALLLWSGVTIFIFGILIDLFR |
| Ga0213871_101850272 | 3300021441 | Rhizosphere | AMRVLRSAYLSRIMPHRTRGDAILALLLWSGVTVFIFGIIINLFR |
| Ga0213878_100249053 | 3300021444 | Bulk Soil | MRMLRLADVYRIMPDSARGYTILAALLWGGVTLFVFAIIADLIH |
| Ga0187846_100005328 | 3300021476 | Biofilm | MRMLQSAFVSRIMPDSARAHTILAVLLWGGVTIFIFGIIIDVIR |
| Ga0187846_100260594 | 3300021476 | Biofilm | MRMLRSALVSRMMPDSARGHTILAVLLWGGVTLFIFGILVDVIR |
| Ga0187846_100265202 | 3300021476 | Biofilm | MRMLRSAYVSRIMPDSVRAHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0187846_100654262 | 3300021476 | Biofilm | MRMLRSAYVSWIMPDSARGHTILALLLWVGVTIFIFGILVDVIR |
| Ga0187846_102338791 | 3300021476 | Biofilm | MPRLRSAYLARMMPDAARRQAILTLLLWSGVTIFIFGILIGLFR |
| Ga0187846_102619092 | 3300021476 | Biofilm | MRMLRSAYVSRIMPDSGRAHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0187846_102982342 | 3300021476 | Biofilm | MRVLPSAYVSRIMPDRARADTILALLLWGAVTIFVFGILVDLIR |
| Ga0187846_104648342 | 3300021476 | Biofilm | MRMLRSAYVSRIMPGSARAHTILALLLWGGVTIFIFGIIVDL |
| Ga0210402_106787102 | 3300021478 | Soil | MRMLRSAYLYRMMPDSARAHTILALLLWSGVTIFIFGILIDLFH |
| Ga0210410_103554382 | 3300021479 | Soil | MRMLRSAYLYRMVPDSARAHTILALLLWSGVTVFIFGILIDLFH |
| Ga0126371_1000064920 | 3300021560 | Tropical Forest Soil | MRMLRSADLYRMVPSPPRADTVLAFLLWSGVTVFIFGIIIDLFR |
| Ga0126371_1000704511 | 3300021560 | Tropical Forest Soil | MRMLRSADLYRMVPSPPRAQTVLAFLLWSGVTVFIFGIIIDLFR |
| Ga0126371_100373855 | 3300021560 | Tropical Forest Soil | MPRSAYLARIAPGSARTQTILAFVLWSGVTVFIFGILIDFFR |
| Ga0126371_100416392 | 3300021560 | Tropical Forest Soil | MLRSAYVSRIMPDSPRWDTIFAVLLWGGVLIFIFGIVVDLIH |
| Ga0126371_100451207 | 3300021560 | Tropical Forest Soil | MRILRSAYLNRMMPGPARADTVLALLLWSGVTVFIFGIVIDLFR |
| Ga0126371_100494643 | 3300021560 | Tropical Forest Soil | MPMKRSPYLWRSLLGGTQPQTILALLLWSGVTVFIFGILIDFFR |
| Ga0126371_100953395 | 3300021560 | Tropical Forest Soil | MRMLRSAYLSPIAPGSARAQNILALMLWSGVTVFIFGLFINFFR |
| Ga0126371_101693052 | 3300021560 | Tropical Forest Soil | MRMLRSAYVSRIMPDPARVHTILAVLLWVGVTIFIFGIVVDLIH |
| Ga0126371_101967122 | 3300021560 | Tropical Forest Soil | MRVLRSAYLSRIVPHGMRGEAILALLLWSGVTVFIFGIIIDFFR |
| Ga0126371_102565712 | 3300021560 | Tropical Forest Soil | MRMLRSADISRIMPDSGQRDTILAVLLWGGVTIFIFGILLDLIR |
| Ga0126371_105106623 | 3300021560 | Tropical Forest Soil | MRTLRSACLSRIMPNAPRGNTLLALLLWSGVTVFIFGIIIDLFR |
| Ga0126371_105711862 | 3300021560 | Tropical Forest Soil | MRVLRSAYVSRIMPDRARADTILALLLWGAVTIFVFGILVDLIH |
| Ga0126371_107041352 | 3300021560 | Tropical Forest Soil | MRVLRSADLYRMVPDAARAHTILAFLLWSGVTVFIFGIIIDLFR |
| Ga0126371_111807241 | 3300021560 | Tropical Forest Soil | MRMLRSAYVSRIMPDPARVHTILAFLLWGGVTIFIFGILLDVIR |
| Ga0126371_112586102 | 3300021560 | Tropical Forest Soil | SADLSRIMPGAPTANTIIALLLWSGVTVFIFGIIIDLFR |
| Ga0126371_116839082 | 3300021560 | Tropical Forest Soil | MRMLRLADVYRIMPDSARAHTILAVLLWGGVTLFVFGIITDLIH |
| Ga0126371_122174152 | 3300021560 | Tropical Forest Soil | MRMLRSAYLSMIMPDSARAHTILAFLLWGGVTIFIFGILLDVIR |
| Ga0126371_135200802 | 3300021560 | Tropical Forest Soil | MRTLRPACLSRIMPNAPRGNTVFALLLWRGVTVFIFGIIIDLFR |
| Ga0242645_10308981 | 3300022501 | Soil | MSDAMRMLRSAYLSRVVPDSARVQTILALLLWSGVTVFIFGILIDLFR |
| Ga0222729_10678402 | 3300022507 | Soil | LRSAYLSRVVPDSARVQTILALLLWSGVTVFIFGILIDLVH |
| Ga0242652_10394842 | 3300022510 | Soil | WRSGAMRMLRSTYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0242652_10521241 | 3300022510 | Soil | RAMRMLRSADVSWMMPDSVRGHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0242676_10055902 | 3300022512 | Soil | MSDAMRMLRSAYLSRVVPDSARAQTLLAFLLWSGVTVFIFGILIDLFR |
| Ga0242664_11040372 | 3300022527 | Soil | MLRSAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDWFR |
| Ga0242664_11293511 | 3300022527 | Soil | SGAMRMLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0242669_10841481 | 3300022528 | Soil | AMRMLRSAYFSRVAPDSARVQTILALLLWSGVTVFIFGILIDWFR |
| Ga0242660_10613902 | 3300022531 | Soil | YLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR |
| Ga0242662_100452613 | 3300022533 | Soil | MRMLWSAYLYRMVPDSARAHTILALLLWSGVTVFIFGILIDLFH |
| Ga0242662_102074111 | 3300022533 | Soil | PAKLRERAMRMLRSADVSWMMPDSVRGHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0242662_102332481 | 3300022533 | Soil | RSGAMRMLRSAHLYRMVPDSARAHTILALLLWSGVTVFIFGILIDLFH |
| Ga0242662_102532192 | 3300022533 | Soil | SAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0242665_100370281 | 3300022724 | Soil | PRWRSGAMRMLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0242665_103283102 | 3300022724 | Soil | GPPSWRSGAMRMLRSAYLTRIMPGSARADTILALLLWGGVTIFIFGILVDVIR |
| Ga0242654_100923142 | 3300022726 | Soil | MRMLRSAYITRIMPGSARADTILALLLWGGVTIFIFGILVDVIR |
| Ga0242654_101507182 | 3300022726 | Soil | MRMLRSANVSRIMPDSPRWDTIVAALLWGVVTIFIFGILVDLIR |
| Ga0207699_104063223 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDAMRMLRSAYLSRVVPDSSRAQTVLAFLLWSGVTVFIFGILMDLFR |
| Ga0207663_101599133 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIKRSGYLSRVLPGAAHAQTILALLLWSGVTIFIFGILIDFFR |
| Ga0207646_105869202 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMLRSADLYGMVPSSARAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0257160_11017661 | 3300026489 | Soil | AMRMLRSAYLYRMMPDSARAHTILALLLWSGVTVFIFGILIDLFR |
| Ga0209807_11285032 | 3300026530 | Soil | MSDEMRILRSAYLSRVVPDSARAQTILALLLWSGVTIFIFGILIDLFR |
| Ga0209648_100112475 | 3300026551 | Grasslands Soil | MRMLRSAYLSRVVPDSARAETILALLLWSGVTVFIFGILIDWFR |
| Ga0209648_106358182 | 3300026551 | Grasslands Soil | MRMLRSAYLYRMVPDTARAHTILALLLWSGVTVFIFGILIDLIH |
| Ga0207802_10211812 | 3300026847 | Tropical Forest Soil | MRMLRSAYVSRIMPDSARVHTILAVLLWGGVTIFIFGILVDLIR |
| Ga0208092_1008942 | 3300027074 | Forest Soil | MSDAMRMLRSAYLSRVVPDSARAQTIFALLLWSGVTVFIFGILIDLFR |
| Ga0208860_10167271 | 3300027076 | Forest Soil | MRMLRSAPLSRVVPDSARAQTILALLLWSGVTVFIFGI |
| Ga0208094_1037251 | 3300027094 | Forest Soil | MRMLRSAYLYRMMPDSARAHTILALLLWSGVTVFIFGILIDLFR |
| Ga0207946_1074542 | 3300027108 | Forest Soil | RSGAMRMLRSAYRYRMVPDSARAHTILALLLWSGVTVFIFGILIDLFR |
| Ga0208241_10439462 | 3300027297 | Forest Soil | MSDAMRMLRSAYLSRVVPDSARAQTLLAFLLWSGVTVFIFSILI |
| Ga0209004_10868461 | 3300027376 | Forest Soil | MSDAMRVQRSAYLSRVVLDSARAQTILALLLWSGVTVFIFGILLDLFR |
| Ga0209527_10097834 | 3300027583 | Forest Soil | LSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR |
| Ga0209331_10198632 | 3300027603 | Forest Soil | MRMLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGIIVDVIR |
| Ga0209528_10030343 | 3300027610 | Forest Soil | MRMLRSGYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR |
| Ga0209625_10019974 | 3300027635 | Forest Soil | MRMLRSAYLSRIVPDSARAQTILALLLWSGVTVFIFGILIDLFR |
| Ga0209217_10004145 | 3300027651 | Forest Soil | MRMLRSADVYRIMPHSGRAHTILALLLWGGVTIFIFGIIVDVIR |
| Ga0207826_11938252 | 3300027680 | Tropical Forest Soil | MRMLRSAYVSRIMPDSARVHTILAVLLWSGVTIFIFGILVDL |
| Ga0209626_10996242 | 3300027684 | Forest Soil | MRMLRSADLYRMMPDSARAHTILALLLWSGVTVFIF |
| Ga0209446_10024035 | 3300027698 | Bog Forest Soil | MRMLRSADVSRIMPDSARGHTILAILLWGGVTIFIFGILVDLIR |
| Ga0209446_10066783 | 3300027698 | Bog Forest Soil | MRMLRSAYVSRIMSDSARGHTILAILLWGGVTIFIFGILVDVIR |
| Ga0209446_10649732 | 3300027698 | Bog Forest Soil | MRMLRSAYVSRMMPDSARGHTILAVLLWGGVTIFIFGILLDVIR |
| Ga0209447_101445031 | 3300027701 | Bog Forest Soil | MSDAMRMLRSAYLSRVAPDSARAQDIFALLLWSGVTVFIFGILIDWFR |
| Ga0209328_100489662 | 3300027727 | Forest Soil | MSHAMRMLRTAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR |
| Ga0209038_100237492 | 3300027737 | Bog Forest Soil | MSDAMRMLRSAYRSWVMPDSARAQNILALLLWSGVTVFIFGILIDWFR |
| Ga0209448_102129022 | 3300027783 | Bog Forest Soil | MSDAMRMLRSAYRSWVMPDSARAQNILALLLWSGVTVFIFGILIDLFR |
| Ga0209074_103814141 | 3300027787 | Agricultural Soil | MRMLRSAYLSRVLPDSARAETILALLLWSGVTVFIFGILIDWFR |
| Ga0209074_104678391 | 3300027787 | Agricultural Soil | MSDAMRMLWSAYLSRIVPDSARAETILALLLWSGVTVFIFGILIDVVR |
| Ga0209139_101818202 | 3300027795 | Bog Forest Soil | MRMLRSAYLSRVAPDSARAQDIFALLLWSGVTVFI |
| Ga0209656_102610232 | 3300027812 | Bog Forest Soil | MHMLWSAYLSRMVPDSARTQTILALLLWSGVTVFIFGIIIDFFR |
| Ga0209180_103853551 | 3300027846 | Vadose Zone Soil | MRVLRSAYLYRMVPDSARAHTILALLLWSGVTVFIFGILIDLFH |
| Ga0209465_100540192 | 3300027874 | Tropical Forest Soil | MRMLRSAELYRMVPRPPRAQTVLAFLLWSGVTVFIFGIIIDLFR |
| Ga0209465_101831001 | 3300027874 | Tropical Forest Soil | MRTLRSACLSRIMPNAPRGNTILALLLWSGVTVFIFGIIIDL |
| Ga0137415_107322381 | 3300028536 | Vadose Zone Soil | WRSGAMRMLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0308309_100511052 | 3300028906 | Soil | MRMLRSAPLSRVVPDSARVQTILALLLWSGVTVFIFGILIDWFR |
| Ga0222748_10872741 | 3300029701 | Soil | SDAMRMLRSAPLSRVVPDSARAQTILGLLLWSGVTIFIFGILIDWFR |
| Ga0222748_11289072 | 3300029701 | Soil | MSDAMRMLRSAYLSRVVPDSARAQTLLAFLLWSGVTVFIFGILIDLVH |
| Ga0075399_112330512 | 3300030967 | Soil | RSGAMRMLRSAYISRIMPDSLPGDTILAVLLWGGVTIFIFGILLDLIR |
| Ga0075399_114709812 | 3300030967 | Soil | RSGAMRMLRSGYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0075394_100030532 | 3300030969 | Soil | MRMLRLAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0075394_116966502 | 3300030969 | Soil | MRVLRSACVSRIMPDSLPGDTILAVLLWGGVTIFIFGILLDLIR |
| Ga0170834_1000102912 | 3300031057 | Forest Soil | MRKLRSASVLRIMPDAARLETILAILLWGGVTIFIFGILIDVIR |
| Ga0170834_1021416083 | 3300031057 | Forest Soil | MRMLRSAYISRIMPDSLPGDTILAVLLWGGVTIFIFGILLDLIR |
| Ga0170834_1071234034 | 3300031057 | Forest Soil | GCWMSDAMRMLRSAYLSGVVPDSARAQTLLAFLLWSGVTVFIFGILIDWFR |
| Ga0308189_102802001 | 3300031058 | Soil | SNAMRVLRSAYLHRMVPDSARAHTILALLLWSGVTIFIFGILIDFFH |
| Ga0308197_103061121 | 3300031093 | Soil | DAMRMLRSAYLSRVVPDSSRAQTILAFLLWSGVTVFIFGILMDLFR |
| Ga0308193_10923001 | 3300031096 | Soil | PSCWMSDAMRMLRSAYLSRVVPDSSRAQTILAFLLWSGVTVFIFGILMDLFR |
| Ga0170822_145235591 | 3300031122 | Forest Soil | MRKLRSASVLRIMPDAARLETIIAILLWGGVTIFIFGILIDVIR |
| Ga0170824_1037020682 | 3300031231 | Forest Soil | MRVLRSACVSRIMPDSLRWDTILAVLLWGGVTSFIFGIVVDLIH |
| Ga0170824_1057075674 | 3300031231 | Forest Soil | MRMLRSAYVSRIMPDSLRWDTIVAALLWGVVTIFIFGILVDLIR |
| Ga0170824_1110597892 | 3300031231 | Forest Soil | MRMLRSAYVSRIMPDSMRWDTILAVLLWGGVTIFIFGIVVDLIH |
| Ga0170824_1131359972 | 3300031231 | Forest Soil | AYLSRVVPDSARAQTLLAFLLWSGVTVFIFGILIDWFR |
| Ga0170824_1135233142 | 3300031231 | Forest Soil | MRMLRSAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLVH |
| Ga0170824_1138624101 | 3300031231 | Forest Soil | RSGAMRMLRSAYVSRIMPDSGRAHTILALLLWGGVTIFIFGILIDVIR |
| Ga0170824_1209063273 | 3300031231 | Forest Soil | MHMLRSAYLSRVVPDSARTQTLLALLLWSGVTVFIFGIIIDFFR |
| Ga0170824_1279558772 | 3300031231 | Forest Soil | CWMSDAMRMLRSAYLSRVVSGSARAETILALLLWSGVTVFIFGILIDLFR |
| Ga0170820_127645502 | 3300031446 | Forest Soil | MRVLRSACISRIMPESLRWDTILAVLLWGGVTSFIFGIVVDLIH |
| Ga0170820_131013133 | 3300031446 | Forest Soil | LRSAYVYRIMPTWRSGAMRMLRSAYVYRIMPDSGRAHTILALLLWGGVTIFIFGILIDVI |
| Ga0170819_108147702 | 3300031469 | Forest Soil | MSDAMRMLRSAYLSRGVPDSARAQTILALLLWSGVTVFIFGILIDWFR |
| Ga0170819_125643302 | 3300031469 | Forest Soil | MRMLRSAYISRIMPDSGRRDTILAVLLWGGVTIFIFGILLDLIH |
| Ga0170819_140094702 | 3300031469 | Forest Soil | MRMLRSAYVSRIMPDSLRWDTILAVLLWGGVTIFIFGIVVDVIH |
| Ga0170819_169586563 | 3300031469 | Forest Soil | MRVLRSAYISRIMPDSLPGDTILAVLLWGGVTIFIFGILLDLIR |
| Ga0170818_1011745313 | 3300031474 | Forest Soil | MGMLRSAYISRIMPDSLPGDTILAVLLWSGVTIFIFGILLDLIR |
| Ga0170818_1093663011 | 3300031474 | Forest Soil | RSAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLVH |
| Ga0170818_1129994191 | 3300031474 | Forest Soil | MRMLRSAYLSRVVPGSAQTETILALLLWSGVTVFIFGILIDLFR |
| Ga0318516_1000002026 | 3300031543 | Soil | MRALRSACLSRIMPNAPRGNTILALLLWSGVTIFIFGIIIDLFR |
| Ga0318516_100137152 | 3300031543 | Soil | MRRLRSASVLRIMPDAVRLETILAILLWGGVTIFIFGILIDVIR |
| Ga0318516_100836652 | 3300031543 | Soil | MRMLRSAYVFRIMPDSVRAHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0318516_100845052 | 3300031543 | Soil | MRMLRSAYVSRMMPDSGRAHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0318516_100951782 | 3300031543 | Soil | MRMLRSADLYGMVPSSARAQTILALLLWGGVTAFIFGIVIDLFH |
| Ga0318516_101085332 | 3300031543 | Soil | MRMLRSAYVSWMMPDSVRGHTLLAVLLWGGVTIFIFGILVDVIR |
| Ga0318516_102223242 | 3300031543 | Soil | MRMLRSAFVSRMMPDSARGHTILAVLLWGGVTLFIFGILVDVIR |
| Ga0318516_102362012 | 3300031543 | Soil | MRMLRSAYLSRMVPDSARGHTILALLLWSGVTIFIFGILIDLIH |
| Ga0318516_102658741 | 3300031543 | Soil | MRMPRSAYISRIMPDSARAHTILAFLLWGGVTIFIFGILLDVIR |
| Ga0318516_103201592 | 3300031543 | Soil | MRMLGSARLSRIMPDSPRVDTILALLLWGGVTIFIFGILLDVIR |
| Ga0318516_103383712 | 3300031543 | Soil | MRMLRSAYVSRIMPDSARAHTILAFLLWGGVTIFIFGILFDVIR |
| Ga0318534_100035922 | 3300031544 | Soil | MRRLRSASVLRIMPDAARLETILAILLWGGVTIFIFGILIDVIR |
| Ga0318534_105238511 | 3300031544 | Soil | RCGAMRMPRSAYISRIMPDSARAHTILAFLLWGGVTIFIFGILLDVIR |
| Ga0318541_100447241 | 3300031545 | Soil | WSDGMRRLRSASVLRIMPDAVRLETILAILLWGGVTIFIFGILIDVIR |
| Ga0318538_102415632 | 3300031546 | Soil | MRMLRSAYLSRMVPDSARGHTILALLLWSGVTIFIFGILID |
| Ga0318573_100409583 | 3300031564 | Soil | MRMLRSAYISWMMPDSVRGHTTLAVLLWGGVTIFIFGILVDVIR |
| Ga0318573_101348441 | 3300031564 | Soil | LRWWWSDGMRRLRSASVLRIMPDAVRLETILAILLWGGVTIFIFGILIDVIR |
| Ga0310915_100109626 | 3300031573 | Soil | MRMLRSAYVSWMMPDSVRGHTTLAVLLWGGVTIFIFGILVDVIR |
| Ga0310915_105812832 | 3300031573 | Soil | SDAMRMLRSADLYRMVPDAARAHTILAVLLWSGVTVFIFGIIIDLFR |
| Ga0310915_112850231 | 3300031573 | Soil | MRMLRSADLYRMVPDAGRAHTVLAFLLWSGVTIFIFGIIIDLFR |
| Ga0307483_10286491 | 3300031590 | Hardwood Forest Soil | MRMLQSAYVSRIMPDSGRVHTILAVLLWGGVTIFILGILVDVIR |
| Ga0307483_10293471 | 3300031590 | Hardwood Forest Soil | AMRMLRSADVSWMMPDSVRGHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0318555_105167432 | 3300031640 | Soil | MLRSADLYGMVPSSARAQTILALLLWGGVTAFIFGIVIDLFH |
| Ga0318572_105918762 | 3300031681 | Soil | MRMLRSAFLYRMVPGSAGVHTILALLLWSGVTVFIFGILIDFFH |
| Ga0318560_100378372 | 3300031682 | Soil | MRMLRSADLYRMVPDAARAHTILAVLLWSGVTVFIFGIIIDLFR |
| Ga0318560_107255782 | 3300031682 | Soil | AGGTDAMRMLRSAYVSRIMPDSLQWNTIFAVLLWGGVTIFIFGIVVDLIH |
| Ga0306917_101003344 | 3300031719 | Soil | RAMRMLRSAYISWMMPDSVRGHTTLAVLLWGGVTIFIFGILVDVIR |
| Ga0306917_103038531 | 3300031719 | Soil | LSWMMPDSVRGHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0306917_110197742 | 3300031719 | Soil | SADISRIMPDSGQRDTILAVLLWGGVTIFIFGILLDLIR |
| Ga0307469_111802262 | 3300031720 | Hardwood Forest Soil | MRMLRTAYVSRIMPDSGRAHTILALLLWAGVTIFIFGILVDVIR |
| Ga0318493_104451582 | 3300031723 | Soil | RVLRSADLYRMVPDAARAHTILAFLLWSGVTVFIFGIIIDLFR |
| Ga0318500_103013041 | 3300031724 | Soil | MRMLGSARLSRIMPDSPRVDTILALLLWGGVTIFIFG |
| Ga0307468_1015718072 | 3300031740 | Hardwood Forest Soil | MRMLRSAYVSRIMPDPGRAHTILALLLWGGVTIFIFGILVDVIR |
| Ga0306918_101460152 | 3300031744 | Soil | MSDAMRMLRSADLSRVVPDSARTQTLLAFLLWSGVTVFIFGILIDWFR |
| Ga0318502_105621302 | 3300031747 | Soil | MLRSAFVSRMMPDSARGHTILAVLLWGGVTLFIFGILVDVIR |
| Ga0318492_104992171 | 3300031748 | Soil | MRMLRSAFVSRMMPDSARGHTILAVLLWGGVTLFIFGILV |
| Ga0307477_1000092525 | 3300031753 | Hardwood Forest Soil | MRMLRSAYVSRIMPDSARAHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0307477_102307691 | 3300031753 | Hardwood Forest Soil | MRMLRSAYLSRVVPDSARAQTIFALLLWSGVTVFIFGILIDLF |
| Ga0307477_110455781 | 3300031753 | Hardwood Forest Soil | MSDAMRMLRSAPLSRVVLDSARAQTILALLLWSGVTVFIFGILIDWFR |
| Ga0307475_102112841 | 3300031754 | Hardwood Forest Soil | LKERAMRMLRSAYVSWMMPDSVRGHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0318537_102046742 | 3300031763 | Soil | MLRSAYLSWMMPDSVRGHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0318509_103923552 | 3300031768 | Soil | MRTLRWACLSRIMPNAPRGNTLLALLLWSGVTVFIFGIIIDLFR |
| Ga0318509_107105931 | 3300031768 | Soil | AMRMLRLADVYRMMPDSARAHTILAVLLWGGVTLFVFGIITDLIR |
| Ga0318521_100060956 | 3300031770 | Soil | MRMLGSARLSRIMPDSPRVDTILAFLLWGGVTIFIFGILLDVIR |
| Ga0318543_101709523 | 3300031777 | Soil | AMRMLRSAYVSWMMPDSVRGHTLLAVLLWGGVTIFIFGILVDVIR |
| Ga0318543_103248482 | 3300031777 | Soil | MRMLRSAYVSRIMPDSLQWNTIFAVLLWGGVTIFIFGIVVDLIH |
| Ga0318498_103856981 | 3300031778 | Soil | MRMLRSAYVSWMMPDSVRGHTLLAVLLWGGVTIFIFGILVDV |
| Ga0318508_10640921 | 3300031780 | Soil | MRMLRSAYVSWMMPDSVRGHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0318547_109175281 | 3300031781 | Soil | MRVLRSADLYRMVPDAARAHTILAVLLWSGVTVFIFGIIIDLFR |
| Ga0318548_104769651 | 3300031793 | Soil | YGMVPSSARAQTILALLLWGGVTAFIFGIVIDLFH |
| Ga0318503_100858462 | 3300031794 | Soil | MRMLRSAYLSRMVPDSARGHTILALLLWSGVTIFI |
| Ga0318550_100700682 | 3300031797 | Soil | MRVLRSADLYRMVPDAVRAHTILAFLLWSGVTVFIFGIIIDLFR |
| Ga0318497_103535361 | 3300031805 | Soil | RSAYISRIRPDSARAHTILAFLLWGGVTIFIFGILLDVIR |
| Ga0318497_106583001 | 3300031805 | Soil | MRMLRSAYVSRIMPDSARGHTILAVLLWGGVTIFIFGIL |
| Ga0318567_101467571 | 3300031821 | Soil | MRMLRSAYISWMMPDSVRGHTLLAVLLWGGVTIFIFGILVDVIR |
| Ga0307478_106169082 | 3300031823 | Hardwood Forest Soil | LRSAYLSRVVPDSARAQTILALLLWSGVTVFIFGILIDLFR |
| Ga0310917_101153713 | 3300031833 | Soil | AYISWMMPDSVRGHTTLAVLLWGGVTIFIFGILVDVIR |
| Ga0310917_104343462 | 3300031833 | Soil | MRMLRSADLYRMVPDAGRAHTVLAFLLWSGVTIFIFGII |
| Ga0318511_100828192 | 3300031845 | Soil | MRMLRSAYVSRMMPDSVRGHTTLAVLLWGGVTLFIFGILVDVIR |
| Ga0316049_1156171 | 3300031866 | Soil | MRMLRSAYVSRMMPDSGRAHTVLAVLLWGGVTIFIFGILLDVIR |
| Ga0306919_100827122 | 3300031879 | Soil | MRMLRSAYGSRIMPDSARAHTILAFLLWGGVTIFIFGIVVDVIR |
| Ga0306919_101145921 | 3300031879 | Soil | MRMLGSARLSRIMPDSPRVDTILALLLWGGVTIFIF |
| Ga0306925_106010682 | 3300031890 | Soil | MRMLRSAYVSRIMPDSLQWNTIFAILLWGGVTIFIFGIVVDLIH |
| Ga0306925_107810852 | 3300031890 | Soil | MRMLRSAYVSQIMPDSARVHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0318522_103995612 | 3300031894 | Soil | MRMLRSAYVSRIMPDSARAHTILAFLLWGGVTIFIFGIVVDVIR |
| Ga0306923_103363533 | 3300031910 | Soil | MSDAMRMLRSAYLSRVVPDSARAQTLLAFLLWSGVTVFIFGILIDWFR |
| Ga0306923_110866532 | 3300031910 | Soil | MRMLRSVYLYRMVPDSARAHTILALLLWSGVTVFIFGILIDLIR |
| Ga0306921_101414123 | 3300031912 | Soil | MRMLRSAYLSWMMPDSVRGHTILAVLLWGGVTIFIFGILVDVIR |
| Ga0310916_105508581 | 3300031942 | Soil | MRMLRSAYLSRMVPDSARGHTILALLLWSGVTIFIFGILI |
| Ga0310916_116621381 | 3300031942 | Soil | MRMLRLADVYRMMPDSARAHTILAVLLWGGLTLFVFG |
| Ga0310910_100782213 | 3300031946 | Soil | MRMLRSAFVSRMMPDSARGHTILAVLLWGGVTLFIFGILEDVIR |
| Ga0310910_111432652 | 3300031946 | Soil | RSAYISRIMPDSARAHTILAFLLWGGVTIFIFGILLDVIR |
| Ga0310909_103835803 | 3300031947 | Soil | GAAHMRMLRSAFLYRMVPGSAGVHTILALLLWSGVTVFIFGILIDFFH |
| Ga0310909_104884712 | 3300031947 | Soil | MRMLRLADVYRMMPDSARAHTILAVLLWGGVTLFVFGIITDLIH |
| Ga0306926_111709022 | 3300031954 | Soil | MDEAMPMPRSAYLARITPGSARAQTILAFVLWSGVTVFIFGILIDFFR |
| Ga0318530_104278422 | 3300031959 | Soil | MRMLRLADVYRMMPDSARAHTILAVLLWGGVTLFVFGII |
| Ga0306922_103037362 | 3300032001 | Soil | MRMLRSAYVSRIMPDSARAHTILAFLLWGGVTIFIFGILFDVI |
| Ga0318569_106178282 | 3300032010 | Soil | VYRMMPDSARAHTILAVLLWGGVTLFVFGIITDLIH |
| Ga0318507_103537322 | 3300032025 | Soil | MRMLRSAYLSRVVPDSARAQTLLAFLLWSGFTVFIFGILIDWFR |
| Ga0318507_105233652 | 3300032025 | Soil | THSRWWRSGAMRMLRSAYLSRMVPDSARGHTILALLLWSGVTIFIFGILIDLIH |
| Ga0318507_105431131 | 3300032025 | Soil | MRMLRSAYVSRIMPDSARAHTILAFLLWGGVTIFIFGILLDVIR |
| Ga0310911_101845721 | 3300032035 | Soil | RRLRSASVLRIMPDAVRLETILAILLWGGVTIFIFGILIDVIR |
| Ga0310911_102903261 | 3300032035 | Soil | MRMLRSADLYGMVPSSARAQTILALLLWGGVTAFIFGI |
| Ga0318549_100189961 | 3300032041 | Soil | MRALRSACLSRIMPNAPRGNTILALLLWSGVTIFI |
| Ga0318532_103163582 | 3300032051 | Soil | RSAYVSRIMPDSLQWNTIFAVLLWGGVTIFIFGIVVDLIH |
| Ga0318570_101428061 | 3300032054 | Soil | MRMLRSAYISWMMPDSVRGHTTLAVLLWGGVTIFIFGILVDVIC |
| Ga0318533_103137593 | 3300032059 | Soil | AYISRIMPDSARAHTILAFLLWGGVTIFIFGILLDVIR |
| Ga0318533_109965061 | 3300032059 | Soil | MRMLRLADVYRMMPDSARAHTILAVLLWGGVTLFVF |
| Ga0311301_123563381 | 3300032160 | Peatlands Soil | MLRSAYLSRMMPDSARAHRVFALLLWSGVTIFIFGILVDLIR |
| Ga0307471_1005196933 | 3300032180 | Hardwood Forest Soil | RSAYVSRIMPDSGRAHTILALLLWSGVTIFIFGILVDVIR |
| Ga0307471_1012074671 | 3300032180 | Hardwood Forest Soil | MRMLRSAYVSRIMPDSLRWDTIVAALLWGVVTIFIFGILIDLIR |
| Ga0307472_1001176932 | 3300032205 | Hardwood Forest Soil | MRMLRSAYVSRIMPDSGRAHTILALLLWSGVTIFIFGILVDVIR |
| Ga0306920_1004113252 | 3300032261 | Soil | MRMLRSAFVSRIMPDSARAHTILAFLLWGGVTIFIFGILLDVIR |
| Ga0306920_1007149421 | 3300032261 | Soil | MRMLRSAYISWMMPDSVRGHTTLAVLLWGGVTIFIF |
| Ga0306920_1007814751 | 3300032261 | Soil | MRMLRLADVYRMMPDSARGHTILAVLLWGGVTLFVFAIITDLIR |
| Ga0306920_1013433841 | 3300032261 | Soil | MRMLRLADVYRMMPDSARAHTILAVLLWGGVTLFVFGI |
| Ga0306920_1042888821 | 3300032261 | Soil | MRMLRSADLYRMVPDAARANAILAFLLWIGVTVFIFGIIIDLFR |
| Ga0348332_120816192 | 3300032515 | Plant Litter | MRMLRSAYVSRMMPDSGRAHTILAVLLWGGVTIFIFGILLDVIR |
| Ga0310914_118075772 | 3300033289 | Soil | MRMLRSAFVSRIMPDSARAHTILAFLLWGGVTIFIFGILLYVIR |
| Ga0318519_105595282 | 3300033290 | Soil | MRMPRSAYISRIMPDSARAHTILAFLLWGGVTIFIFGILLD |
| ⦗Top⦘ |