| Basic Information | |
|---|---|
| Family ID | F003666 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 474 |
| Average Sequence Length | 36 residues |
| Representative Sequence | VRIHGGEFGESARAIHRTESEKSGSSRIGEIPRFD |
| Number of Associated Samples | 190 |
| Number of Associated Scaffolds | 474 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 65.82 % |
| Associated GOLD sequencing projects | 188 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (87.764 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (46.203 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.190 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (90.928 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 474 Family Scaffolds |
|---|---|---|
| PF02369 | Big_1 | 2.53 |
| PF16363 | GDP_Man_Dehyd | 0.42 |
| PF07703 | A2M_BRD | 0.21 |
| PF04932 | Wzy_C | 0.21 |
| COG ID | Name | Functional Category | % Frequency in 474 Family Scaffolds |
|---|---|---|---|
| COG2373 | Uncharacterized conserved protein YfaS, alpha-2-macroglobulin family | General function prediction only [R] | 0.21 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 87.76 % |
| All Organisms | root | All Organisms | 12.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 46.20% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 22.57% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.70% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.59% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.42% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.21% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.21% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.21% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004789 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006355 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007319 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007321 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007534 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300008587 | Microbial communities of Cyanobacterial mats from a recreation lake in Champs-sur-Marne, France - CSM2012-AB-F-D | Environmental | Open in IMG/M |
| 3300008957 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT2 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010307 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012687 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES032 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012688 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES030 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012705 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES047 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012709 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012710 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES041 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012712 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012713 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES033 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012718 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES050 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012721 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012727 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES016 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012728 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES043 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012732 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES039 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012738 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES023 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012739 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES028 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012740 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES018 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012744 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES020 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012748 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES045 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012751 | Freshwater microbial communities from Lake Montjoie, Canada - M_130821_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012752 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012753 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES038 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012755 | Freshwater microbial communities from Lake Montjoie, Canada - M_140807_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012757 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012758 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130626_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012759 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012760 | Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012761 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012762 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES046 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012764 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012766 | Freshwater microbial communities from Lake Montjoie, Canada - M_140807_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012769 | Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012770 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012775 | Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012776 | Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012777 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140709_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012781 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130712_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012783 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES002 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012959 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES150 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012990 | Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015 | Engineered | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300015243 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES148 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016681 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES152 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016683 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES128 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016690 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES019 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016693 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES036 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016694 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES040 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016697 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016699 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES160 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019114 | Metatranscriptome of marine microbial communities from Baltic Sea - GS856_ls5 | Environmental | Open in IMG/M |
| 3300019200 | Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021282 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021473 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-15m | Environmental | Open in IMG/M |
| 3300021849 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022166 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022374 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022375 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023708 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024485 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024487 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024530 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024534 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024535 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024537 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024539 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024542 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024543 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024546 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024549 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024554 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024558 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024564 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024848 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024849 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024851 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024856 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024861 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025742 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025744 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025745 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025746 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025747 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025749 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025753 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025756 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025757 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025760 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025763 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026412 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026415 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026425 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026429 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026435 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026454 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026565 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028078 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028080 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028088 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028089 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028097 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028101 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028255 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028261 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028266 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028271 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028329 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300029697 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029699 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0007752_100627861 | 3300004789 | Freshwater Lake | KQINWFPRRVRIHGGEFGESARAIHRNEPEKSGSSRDREILELD* |
| Ga0007761_101156371 | 3300004792 | Freshwater Lake | NRFPRRVRIHGGEFGESARAIHRTESEKSDSSRIEEIPWFD* |
| Ga0007756_100242161 | 3300004795 | Freshwater Lake | FPRRVRIRGGEFGESARAIHRTESEKSDSSQGQEIPGLD* |
| Ga0007756_100946061 | 3300004795 | Freshwater Lake | NRFPRRVRIHGGEFGESARAIHRTESEKSGSSRIEEIPRFD* |
| Ga0007764_100063201 | 3300004797 | Freshwater Lake | FPRRVRIHGGEFGESARAIHRNESEKSGSSRIEEIPRFD* |
| Ga0007764_100396402 | 3300004797 | Freshwater Lake | KNRFPRRVRIHGGEFGESARAIHRTESEKSDSSRVGEIPQFD* |
| Ga0070374_100381912 | 3300005517 | Freshwater Lake | KNRFPRRVRIHGGEFGESARAIHRTESEKSDSSRTREILSID* |
| Ga0068885_10420751 | 3300005565 | Freshwater Lake | VRIHGGEFGESARAIHRIELERSSSSRGREILELD* |
| Ga0068885_11726521 | 3300005565 | Freshwater Lake | VRIRGGEFGESARAIHRTESEKSDSSQGQEIPGLD* |
| Ga0068885_19394012 | 3300005565 | Freshwater Lake | VRIHGGEFGESARAIHRTESEKSGSSRDREILDLD* |
| Ga0068885_19751881 | 3300005565 | Freshwater Lake | RFPRRVRIHGGEFGESARAIHRTESEKSDSSRDGEILDLD* |
| Ga0078894_102202941 | 3300005662 | Freshwater Lake | RVRIHGGEFGESARAIHRNESEKSGSSRDREILELD* |
| Ga0078894_102459672 | 3300005662 | Freshwater Lake | RVRIHGGEFGESARAIHRTELERSSSSRIEEIPRFD* |
| Ga0078894_104811212 | 3300005662 | Freshwater Lake | RRVRIHGGEFGESARAIHRNESEKSGSSRDREIPDLD* |
| Ga0078894_116646431 | 3300005662 | Freshwater Lake | NRFPRRVRIHGGEFGESARAIHRIELEKSGLSRIGEIPRFD* |
| Ga0075501_10065162 | 3300006355 | Aqueous | VRIHGGEFGESARAIHRNEKKLTQSQDQEIPDLD* |
| Ga0075501_13737911 | 3300006355 | Aqueous | RIHGGEFGESARAIHRTESEKSDSSRTGEILSID* |
| Ga0075511_18036441 | 3300006402 | Aqueous | VRIHGGEFGESARAIHRTESEKSDSSREWEIPNLD* |
| Ga0102691_15972052 | 3300007319 | Freshwater Lake | RIHGGEFGESARAIHRIESEKSGSSRIGEIPRFD* |
| Ga0102692_11286781 | 3300007321 | Freshwater Lake | VRIHGGEFGESARAIHRIELERSSSSRIEEIPWFD* |
| Ga0102692_16282972 | 3300007321 | Freshwater Lake | INRFPRRVRIHGGEFGESARAIHRIELERSSSSRGREILELD* |
| Ga0102690_17086421 | 3300007534 | Freshwater Lake | RIHGGEFGESARAIHRIELERSSSSRIEEIPRFD* |
| Ga0102923_10884032 | 3300007606 | Estuarine | VRIRGGEFGESARAIHRTESERSDSSRVWEIPELD* |
| Ga0105051_110555941 | 3300007722 | Freshwater | INRFPHRVRIHGGEFGESARAIHRTESEQSGSSRFTEIP* |
| Ga0103774_1001112 | 3300008587 | Freshwater Lake | VRIHGGEFGESARAIHRIELERSSSSRIGEIPRFD* |
| Ga0104239_10012841 | 3300008957 | Freshwater | RVRIHGGEFGESARAIHRTELEKSSSSRDREIPELD* |
| Ga0114977_106957992 | 3300009158 | Freshwater Lake | VRIHGGEFGESARAIHRTESEKSDSSRTGEILSID* |
| Ga0114974_103762391 | 3300009183 | Freshwater Lake | INRFPRRVRIHGGEFGESARAIHRTETEKSVSSRAMDRPWFD* |
| Ga0114976_100873021 | 3300009184 | Freshwater Lake | FPRRVRIHGGEFGESARAIHRNESEKSGSSRVEEIPWFD* |
| Ga0114971_100109411 | 3300009185 | Freshwater Lake | RRVRIHGGEFGESARAIHRTESEKSDSSRTREILWLD* |
| Ga0114967_101887471 | 3300010160 | Freshwater Lake | NRFPDRVRIHGGEFGESARAIHRTESEKSDSSRTREILWID* |
| Ga0129319_11520541 | 3300010307 | Aqueous | RIHGGEFGESARAIHRTESEKSDSSRSREILWID* |
| Ga0133913_106300641 | 3300010885 | Freshwater Lake | TKNRFPRRVRIHGGEFGESARAIHRTESEKSDSSRTREILWID* |
| Ga0157543_10063181 | 3300012687 | Freshwater | RIHGGEFGESARAIHRTESEKSGSSRIGEIPRFD* |
| Ga0157543_10135531 | 3300012687 | Freshwater | RIHGGEFGESARAIHRTELEKSGSSRIGEIPRFD* |
| Ga0157543_10324621 | 3300012687 | Freshwater | RIHGGEFGESARAIHRNESEESGSSRIGEIPRFD* |
| Ga0157543_10704062 | 3300012687 | Freshwater | VRIHGGEFGESARAIHRNESEKSDSSRVREIPELD* |
| Ga0157543_10835091 | 3300012687 | Freshwater | RIHGGEFGESARAIHRTELERSSSSRDREIPELD* |
| Ga0157543_11123791 | 3300012687 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRDREILELD* |
| Ga0157543_11349141 | 3300012687 | Freshwater | RVRIHGGEFGESARAIHRTGLERSSSSRDREIPELD* |
| Ga0157543_11414892 | 3300012687 | Freshwater | RIHGGEFGESARAIHRTESEKSGSSRIKEIPWFD* |
| Ga0157541_11108692 | 3300012688 | Freshwater | RIHGGEFGESARAIHRTESEKSGSSRDREILELD* |
| Ga0157541_11990202 | 3300012688 | Freshwater | VRIHGGEFGESARAIHRTELERSSSSRDREIPELD* |
| Ga0157541_12099751 | 3300012688 | Freshwater | VRIHGGEFGESARAIHRTESEKSGSSRDREILELD* |
| Ga0157596_10736341 | 3300012702 | Freshwater | RIHGGEFGESARAIHRIELEKSGSSREREMPELD* |
| Ga0157596_10755362 | 3300012702 | Freshwater | RIHGGEFGESARAIHRTESERSGSSRVWEILELD* |
| Ga0157596_10797402 | 3300012702 | Freshwater | RIHGGEFGESARAIHRTESEKSDSSQGWEIPNLD* |
| Ga0157596_10807562 | 3300012702 | Freshwater | RIHGGEFGESARAIHRIELEKSNSSRVREILELD* |
| Ga0157596_10855112 | 3300012702 | Freshwater | NRFPRRVRIHGGEFGESARAIHRTESEKSDSSRDREILVLD* |
| Ga0157596_11566611 | 3300012702 | Freshwater | VRIHGGEFGESARAIHRIELERSSSSRIEEILQFD* |
| Ga0157596_11650171 | 3300012702 | Freshwater | RIHGGEFGESARAIHRIELEKSSSSRIGEIPRFD* |
| Ga0157596_11670222 | 3300012702 | Freshwater | GIHGGEFGESARAIHRIESEKSDSSRIGEIPRFD* |
| Ga0157596_11696001 | 3300012702 | Freshwater | RVRIHGGEFGESARAIHRIESEKSDSSRIGEIPWFD* |
| Ga0157555_10153461 | 3300012705 | Freshwater | VRIHGGEFGESARAIHRTESEKSGSSRIKEIPWFD* |
| Ga0157555_10877631 | 3300012705 | Freshwater | RIHGGEFGESARAIHRNESERSGSSRDREIPELD* |
| Ga0157555_10891491 | 3300012705 | Freshwater | RIHGGEFGESARAIHRNESEKSGSSRIGEIPQFD* |
| Ga0157555_10985562 | 3300012705 | Freshwater | VRIHGGEFGESARAIHRTESEKFDSSRDREILELD* |
| Ga0157555_11228381 | 3300012705 | Freshwater | VRIHGGEFGESARAIHRNEAEKSGSSRTVEIPRFD* |
| Ga0157555_11582691 | 3300012705 | Freshwater | RIHGGEFGESARAIHRTESEKSDSSRTREILSID* |
| Ga0157555_11795721 | 3300012705 | Freshwater | VRIHGGEFGESARAIHRNEVKKLTSSRAGEILSID* |
| Ga0157555_11948202 | 3300012705 | Freshwater | RIHGGEFGESARAIHRNESEKSGSSRDREIPELD* |
| Ga0157627_10498002 | 3300012706 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSQGWEIPNLD* |
| Ga0157627_10946132 | 3300012706 | Freshwater | RIRGGEFGESARAIHRTESEKSDSSQGQEIPGLD* |
| Ga0157627_11305131 | 3300012706 | Freshwater | RIHGGEFGESARAIHRIELERSSSSRIGEIPHFD* |
| Ga0157627_11311422 | 3300012706 | Freshwater | RIHGGEFGESARAIHRNGMEKSSPSRGREILELD* |
| Ga0157627_11534132 | 3300012706 | Freshwater | VRIHGGEFGESARAIHRNESGKPGSSRDWEILELD* |
| Ga0157627_11716151 | 3300012706 | Freshwater | VRIHGGEFGESARAIHRIELERSSSSRIEEIPRFD* |
| Ga0157623_10046931 | 3300012707 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSRIGEIPRFD* |
| Ga0157623_10477861 | 3300012707 | Freshwater | VRIHGGEFGESARAIHRNGMEKSSPSRGREILELD* |
| Ga0157623_10591291 | 3300012707 | Freshwater | INRFPRRVRIHGGEFGESARAIHRIELERSSSSRIEEIPQFD* |
| Ga0157623_11300681 | 3300012707 | Freshwater | NRFPYRVRIHGGEFGESARAIHRIESERSGSSRIGEIPRFD* |
| Ga0157623_11410071 | 3300012707 | Freshwater | VRIHGGEFEESARAIHRIEPEKFGSSRIGEIPRFD* |
| Ga0157623_11596631 | 3300012707 | Freshwater | VRIHGGEFGESARAIHRNESGKPGSSRYWEILELD* |
| Ga0157595_10085182 | 3300012708 | Freshwater | RIHGGEFGESARAIHRIESEKSGSSRGQEIPGLD* |
| Ga0157595_10122493 | 3300012708 | Freshwater | RIHGGEFGESARAIHRTESEKSGSSQGWEIPNLD* |
| Ga0157595_10650171 | 3300012708 | Freshwater | RIHGGEFGESARAIHRIESEKSDSSRTEEILQFD* |
| Ga0157595_10918862 | 3300012708 | Freshwater | FPRRVRIHGGEFGESARAIHRTESEKSDSSQGWEIPNLD* |
| Ga0157595_11104601 | 3300012708 | Freshwater | RIHGGEFGESARAIHRIELEKSNSSRGREILELD* |
| Ga0157595_11499412 | 3300012708 | Freshwater | VRIHGGEFGESARAIHRIELEKSSSSRIGEIPRFD* |
| Ga0157595_11519541 | 3300012708 | Freshwater | RIHGGEFGESARAIHQIESEKSGSSRDREILELD* |
| Ga0157595_12013211 | 3300012708 | Freshwater | RVRIHGGEFGESARAIHRIELERSSSSRIEEIPQFD* |
| Ga0157595_12078301 | 3300012708 | Freshwater | RIHGGEFGESARAIHRTESEKSDSSRDREILDLD* |
| Ga0157608_10274552 | 3300012709 | Freshwater | RIHGGEFGESARAIHRIESEKSDSSRTGEIPRFD* |
| Ga0157608_10365311 | 3300012709 | Freshwater | VRIHGGEFGESARAIHRIESEKSDSSRIGEIPWFD* |
| Ga0157608_10539591 | 3300012709 | Freshwater | RIHGGEFGESARAIHRTESEKSGSSRTGEIPRFD* |
| Ga0157608_10853591 | 3300012709 | Freshwater | RIHGGEFGESARAIHRNESERSGSSRGREILELD* |
| Ga0157608_11089882 | 3300012709 | Freshwater | RIHGGEFGESARAIHRIELERSSSSRIEEILQFD* |
| Ga0157608_11240671 | 3300012709 | Freshwater | RVRIHGGEFGESARAIHRIELEKSNSSRVREILELD* |
| Ga0157608_12124712 | 3300012709 | Freshwater | RIHGGEFGESARAIHRIELERSSSSRGREIPELD* |
| Ga0157550_11008882 | 3300012710 | Freshwater | RIHGGEFGESARAIHRNESEKSGLSRVLEIPKLD* |
| Ga0157550_11508001 | 3300012710 | Freshwater | RIHGGESGESARAIHRTESEKSDSSRDREILELD* |
| Ga0157550_11633172 | 3300012710 | Freshwater | RIHGGEFGESARAIHRIELEKSSSSRIKEIPWFD* |
| Ga0157550_12142371 | 3300012710 | Freshwater | RIHGGEFGESARAIHRNEPERSGSSRIGEIPRFD* |
| Ga0157598_10201922 | 3300012712 | Freshwater | VRIHGGEFGESARAIHRIESEKSDSSRDREIPDLD* |
| Ga0157544_10042892 | 3300012713 | Freshwater | VRIHGGEFGESARAIHRNESERSGSSRDREIPELD* |
| Ga0157544_10148971 | 3300012713 | Freshwater | RIHGGEFGESARAIHRTESEKSDSSRDREILELD* |
| Ga0157544_10149042 | 3300012713 | Freshwater | RIHGGEFGESARAIHRNESEKSDSSRVREIPELD* |
| Ga0157544_10273482 | 3300012713 | Freshwater | RIHGGEFGESARAIHRNESEKSGSSRDREILELD* |
| Ga0157544_10383161 | 3300012713 | Freshwater | RIHGGEFGESARAIHRNEAEKSGSSRTVEIPRFD* |
| Ga0157544_10804521 | 3300012713 | Freshwater | VRIHGGEFGESARAIHRNESEKSGSSRIKEIPWFD* |
| Ga0157544_10989892 | 3300012713 | Freshwater | RIHGGEFGESARAIHRTESEKSDSSRTREILWFD* |
| Ga0157544_12136661 | 3300012713 | Freshwater | RIHGGEFGESARAIHRTESEKFDSSRDREILELD* |
| Ga0157544_12192851 | 3300012713 | Freshwater | RVRIHGGEFGESARAIHRTESEKSGSSRTREILSID* |
| Ga0157601_10100231 | 3300012714 | Freshwater | RIHGGEFGESARAIHRIESEKSGSSRGREILELD* |
| Ga0157601_10244881 | 3300012714 | Freshwater | VRIHGGEFGESARAIHRIELERSSSSRIEEIPQFD* |
| Ga0157601_10666591 | 3300012714 | Freshwater | RIHGGEFGESARAIHRIESEKSDSSRIGEIPRFD* |
| Ga0157599_10765041 | 3300012715 | Freshwater | RIHGGEFGESARAIHRIELERSSSSRDREIPELD* |
| Ga0157599_12123802 | 3300012715 | Freshwater | RIHGGEFGESARAIHRIESEKSDSSRIGEIPQFD* |
| Ga0157605_10354472 | 3300012716 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRDREILDLD* |
| Ga0157605_10412051 | 3300012716 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRTREILSID* |
| Ga0157605_10715012 | 3300012716 | Freshwater | VRIHGGEFGESARAIHRSGLERSSSSRIGEIPQFD* |
| Ga0157605_11528641 | 3300012716 | Freshwater | VRIHGGEFGESARAIYRIELEKSNSSRGREILELD* |
| Ga0157605_12118542 | 3300012716 | Freshwater | RIHGGEFGESARAIHRIESEKSDSSRIGEIPWFD* |
| Ga0157609_10489232 | 3300012717 | Freshwater | RIHGGEFGESARAIHRIESEKSGSSRDREILELD* |
| Ga0157609_11081442 | 3300012717 | Freshwater | RIHGGEFGESARAIHRSGLERSSSSRIGEIPQFD* |
| Ga0157609_11203391 | 3300012717 | Freshwater | RIHGGEFGESARAIHRIESEQSGSSRGQEIPGLD* |
| Ga0157609_11388772 | 3300012717 | Freshwater | VRIHGGEFGESARAIHRNESERSGSSRGREILELD* |
| Ga0157609_12159011 | 3300012717 | Freshwater | VRIHGGEFGESARAIHRTESEKSGSSRIGEIPRFD* |
| Ga0157609_12370892 | 3300012717 | Freshwater | RRVRIHGGEFGESARAIHRIELERSSSSRIGEIPHFD* |
| Ga0157557_10089421 | 3300012718 | Freshwater | RIHGGEFGESARAIHRNESEKSGSSRDREIPDLD* |
| Ga0157557_11569661 | 3300012718 | Freshwater | VRIHGGEFGESARAIHRNEPEKSGSSRVLEIPKLD* |
| Ga0157557_12105041 | 3300012718 | Freshwater | RIHGGEFGESARAIHRNESEKSGSSRIGEIPRFD* |
| Ga0157557_12731401 | 3300012718 | Freshwater | RIHGGEFGESARAIHRNESEKSGSSRIKEIPWFD* |
| Ga0157600_10055152 | 3300012719 | Freshwater | RIHGGEFGESARAIHRNELEESDSSRVREILELD* |
| Ga0157600_10427841 | 3300012719 | Freshwater | KQLNRFPRRVRIRGGEFGESARAIHRTESEKSDSSQGQEIPGLD* |
| Ga0157600_10522362 | 3300012719 | Freshwater | RIHGGEFGESARAIHRMESEKSGSSRGREVPELD* |
| Ga0157600_11609531 | 3300012719 | Freshwater | VRIHGGEFGESARAIHRNESEKSDSSRIGEIPRFD* |
| Ga0157600_12323351 | 3300012719 | Freshwater | RIHGGEFGESARAIHRIESEKSGSSRIEEIPWFD* |
| Ga0157600_12354261 | 3300012719 | Freshwater | RIHGGEFGESARAIHRTESEKSDSSRDREILVLD* |
| Ga0157613_10511702 | 3300012720 | Freshwater | VRIHGGEFGESARAIHRIESEKSDSSRTEEILQFD* |
| Ga0157613_10719941 | 3300012720 | Freshwater | VRIHGGEFGESARAIHRIESERSGSSRIEEIPRFD* |
| Ga0157613_10986742 | 3300012720 | Freshwater | RIHGGEFGESARAIHRIELERSSSSRIGEIPRFD* |
| Ga0157613_11572871 | 3300012720 | Freshwater | RIHGGEFGESARAIHRIESERSGSSRIGEIPRFD* |
| Ga0157613_11601121 | 3300012720 | Freshwater | RVRIHGGEFGESARAIHRIELERSSSSRIEEIPRFD* |
| Ga0157613_12013112 | 3300012720 | Freshwater | VRIHGGEFGESARAIHRTEPEKSGSSRDREILELD* |
| Ga0157613_12733642 | 3300012720 | Freshwater | RRVRIHGGEFGESARAIHRTESEKSDSSQGWEIPNLD* |
| Ga0157612_10296392 | 3300012721 | Freshwater | VRIHGGEFGESARAIHRIELEKSNSSRVREILELD* |
| Ga0157612_10760581 | 3300012721 | Freshwater | VRIHGGEFGESARAIHRTELERSDSSRTEEILQFD* |
| Ga0157612_10856571 | 3300012721 | Freshwater | LNRFPRRVRIRGGEFGESARAIHRTESEKSDSSQGQEIPGLD* |
| Ga0157612_11333381 | 3300012721 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSRGQEIPGLD* |
| Ga0157612_12452772 | 3300012721 | Freshwater | RRVRIHGGEFGESARAIHRTESEKSGSSRIGEIPRFD* |
| Ga0157630_10046392 | 3300012722 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRDREILVLD* |
| Ga0157630_10146932 | 3300012722 | Freshwater | FPRRVRIHGGEFGESARAIHRIESEKSDSSRTEEILQFD* |
| Ga0157630_10880871 | 3300012722 | Freshwater | RIHGGEFGESARAIHRIELERSSSSREREILELD* |
| Ga0157630_11019732 | 3300012722 | Freshwater | VRIHGGEFGESARAIHRIELERSGSSRIGEIPRFD* |
| Ga0157630_11243931 | 3300012722 | Freshwater | RVRIHGGEFGESARAIHRIELEKSSSSRIGEIPRFD* |
| Ga0157604_10348091 | 3300012723 | Freshwater | PRRVRIHGGEFGESARAIHRTESEKSGSSRTGEIPRFD* |
| Ga0157604_10604621 | 3300012723 | Freshwater | RIHGGEFGESARAIHRTESERSDSSRTEEIPQFD* |
| Ga0157604_11242802 | 3300012723 | Freshwater | VRIHGGEFGESARAIHRIESERSGSSRIGEIPQFD* |
| Ga0157604_11645891 | 3300012723 | Freshwater | RIHGGEFGESARAIHRNELERSSSSRIEEIPRFD* |
| Ga0157604_12345722 | 3300012723 | Freshwater | RIHDGEFGESARAIHRNELERSSSSRIGEIPRFD* |
| Ga0157604_12955501 | 3300012723 | Freshwater | QINRFPRRVRIHGGEFGESARAIHRIELERSSSSRIEEIPRFD* |
| Ga0157610_10264621 | 3300012725 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSREREIPELD* |
| Ga0157610_12577671 | 3300012725 | Freshwater | INRFPRRVRIHGGEFGESARAIHRTESEKSGSSRTGEIPRFD* |
| Ga0157610_13004571 | 3300012725 | Freshwater | RIHGGEFGESARAIHRIELEKSGSSRIGEIPRFD* |
| Ga0157597_10258192 | 3300012726 | Freshwater | RIHGGEFGESARAIHRNESGKPGSSRDWEILELD* |
| Ga0157597_10548611 | 3300012726 | Freshwater | RIHGGEFGESARAIHRTESERSGSSRIEEIPWFD* |
| Ga0157597_11032912 | 3300012726 | Freshwater | NRFPRRVRIHGGEFGESARAIHRTESEKSGSSRIGEIPRFD* |
| Ga0157597_11670302 | 3300012726 | Freshwater | NRFPRRVRIHGGEFGESARAIHRTESEKSDSSRDREILDLD* |
| Ga0157531_10597812 | 3300012727 | Freshwater | VRIHGGEFGESARAIHRTELEKSGSSRIGEIPRFD* |
| Ga0157531_11239731 | 3300012727 | Freshwater | RIHGGEFGESARAIHRTESEKSGSSRTREILSID* |
| Ga0157531_12530612 | 3300012727 | Freshwater | FPRRVRIHGGEFGESARAIHRNESEKSDSSRVREIPELD* |
| Ga0157531_12608461 | 3300012727 | Freshwater | VRIHGGEFGESARAIHRNESEKSGSSRIGEIPQFD* |
| Ga0157552_10638661 | 3300012728 | Freshwater | RVRIHGGEFGESARAIHRNEPERSGSSRIGEIPRFD* |
| Ga0157552_11767072 | 3300012728 | Freshwater | VRIHGGEFGESARAIHRTELEKSGSSREREIPELD* |
| Ga0157552_11817061 | 3300012728 | Freshwater | VRIHGGEFGESARAIHRTELEKSGSSRIKEIPWFD* |
| Ga0157625_10038932 | 3300012729 | Freshwater | VRIHGGEFGESARAIHRIELEKSGSSREREMPELD* |
| Ga0157625_12141722 | 3300012729 | Freshwater | NRFPYRVRIHGGEFGESARAIHRIESERSGSSRIEEIPRFD* |
| Ga0157625_12154351 | 3300012729 | Freshwater | RVHGGEFGESARAIHRIELERSSSSRIGEIPQFD* |
| Ga0157625_12275092 | 3300012729 | Freshwater | RIHGGEFGESARAIHRIGSEKSGSSRIKEIPWFD* |
| Ga0157625_12625612 | 3300012729 | Freshwater | FPRRVRIHGGEFGESARAIHRTESEKSGSSRTGEIPRFD* |
| Ga0157602_10048932 | 3300012730 | Freshwater | RIHGGEFGESARAIHRTEPEKSGSSRDREILELD* |
| Ga0157602_10980392 | 3300012730 | Freshwater | FPRRVRIHGGEFGESARAIHRNESGKPGSSRDWEILELD* |
| Ga0157616_10150711 | 3300012731 | Freshwater | RVRIHGGEFGESARAIHRIESEKSDSSRDREIPDLD* |
| Ga0157616_10196141 | 3300012731 | Freshwater | VRIHGGEFGESARAIHRIESEKSDSSRTGEIPRFD* |
| Ga0157616_11603251 | 3300012731 | Freshwater | RRVRIHGGEFGESARAIHRIELERSSSSRIEEIPQFD* |
| Ga0157616_12009711 | 3300012731 | Freshwater | INRFPRRVRIHGGEFGESARAIHRIELERSSSSRDREIPELD* |
| Ga0157616_12187862 | 3300012731 | Freshwater | RIHGGEFGESARAIHRTELERSSSSRIGEIPRFD* |
| Ga0157616_12303311 | 3300012731 | Freshwater | VRIHGGEFGESARAIHRIELERSSSSRGREIPELD* |
| Ga0157616_12492092 | 3300012731 | Freshwater | RVRIHGGEFGESARAIHRIELERSSSSRIEEILQFD* |
| Ga0157616_12839471 | 3300012731 | Freshwater | VRIHGGEFGESARAIHRIESEKSDSSRIGEIPRFD* |
| Ga0157616_13346301 | 3300012731 | Freshwater | NRFPRRVRIHGGEFGESARAIHRNGMEKSSPSRGREILELD* |
| Ga0157549_10380952 | 3300012732 | Freshwater | FPRRVRIHGGEFGESARAIHRTELERSSSSRDREIPELD* |
| Ga0157549_11892181 | 3300012732 | Freshwater | SSDLRIHGGEFGESARAIHRNESEKSGSSRIKEIPWFD* |
| Ga0157549_13343471 | 3300012732 | Freshwater | VRIHGGEFGESARAIHRNESEKSGSSRDREIPELD* |
| Ga0157606_11418662 | 3300012733 | Freshwater | RIHGGEFGESARAIHRTESERSDSSRGQEIPDLD* |
| Ga0157606_12240862 | 3300012733 | Freshwater | RVRIHGGEFGESARAIHRTEPEKSGSSRDREILELD* |
| Ga0157606_13984561 | 3300012733 | Freshwater | RVRIHGGEFGESARAIHRNESERSGSSRGREILELD* |
| Ga0157615_10308992 | 3300012734 | Freshwater | VRIHGGEFGESARAINRIELERSSSSRIGEIPRFD* |
| Ga0157615_13642441 | 3300012734 | Freshwater | RIHGGEFGESARAIHRIELEKSSSSRSKEIPLID* |
| Ga0157537_1053771 | 3300012738 | Freshwater | KQINRFPRRVRIHGGEFGESARAIHRTESEKSDSSRDREILELD* |
| Ga0157537_1538932 | 3300012738 | Freshwater | VRIHGGEFGESARAIHRNESEKSGLSRVLEIPKLD* |
| Ga0157537_1574841 | 3300012738 | Freshwater | VRIHGGEFGESARAIHRNESEKSGSSRIGEIPRFD* |
| Ga0157540_1186612 | 3300012739 | Freshwater | VRIHGGEFGESARAIHRTELEKSGSSRDREILELD* |
| Ga0157533_1115891 | 3300012740 | Freshwater | RVRIHGGEFGESARAIHRIELEKSSSSRIKEIPWFD* |
| Ga0157534_1092131 | 3300012744 | Freshwater | FPRRVRIHGGEFGESARAIHRTESEKSDSSRDREILELD* |
| Ga0157534_1687752 | 3300012744 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRTREILWFD* |
| Ga0157553_10568002 | 3300012748 | Freshwater | RRVRIHGGEFGESARAIHRNESEKSGLSRVLEIPKLD* |
| Ga0138277_10071182 | 3300012751 | Freshwater Lake | VRIHGGEFGESARAIHRNESEKSGSSRIEEIPRFD* |
| Ga0138277_10517581 | 3300012751 | Freshwater Lake | VRIHGGEFGESARAIHRIELERSNSSRGREILELD* |
| Ga0138277_10557291 | 3300012751 | Freshwater Lake | VRIHGGEFGESARAIHRTELEKSSSSRDREILELD* |
| Ga0138277_10633841 | 3300012751 | Freshwater Lake | VRIHGGEFGESARAIHRNESEKSGSSRDREIPDLD* |
| Ga0157629_11428903 | 3300012752 | Freshwater | VRIHGGEFGESARAIHRTESEKSGSSQGWEIPNLD* |
| Ga0157548_10176091 | 3300012753 | Freshwater | RVRIHGEEFGESARAIHRIESEKSGSSRDREILELD* |
| Ga0157548_11534581 | 3300012753 | Freshwater | RVRIHGGEFGESARAIHRTESEKSDSSRDREILELD* |
| Ga0138281_11313901 | 3300012755 | Freshwater Lake | NGFPRRVRIHGGEFGESARAIHRTESERSDSSRTEEILQFD* |
| Ga0138281_11682942 | 3300012755 | Freshwater Lake | NRFPRRVRIHGGEFGESARAIHRTELEKSGSSRIGEIPPFD* |
| Ga0157628_10523772 | 3300012757 | Freshwater | VRIHGGEFGESARAIHRIESEKSDSSRLGEIPQFD* |
| Ga0157628_10875792 | 3300012757 | Freshwater | VRIHGGEFGESARAIHRIELERSSSSRTGEIPRFD* |
| Ga0138285_10489801 | 3300012758 | Freshwater Lake | VRIHGGEFGESARAIHRTESEKSDSSRTREILWID* |
| Ga0138285_12071001 | 3300012758 | Freshwater Lake | VRIHGGEFGESARAIHRNEVKKLTSSQDQEIPVLD* |
| Ga0138285_12072781 | 3300012758 | Freshwater Lake | VRIHGGEFGESARAIHRNESEKSGSSRVEEIPWFD* |
| Ga0138285_12080841 | 3300012758 | Freshwater Lake | VRIHGGEFGESARAIHRNESEKSDSSRDREILELD* |
| Ga0157626_10267632 | 3300012759 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSRDREILELD* |
| Ga0157626_10948541 | 3300012759 | Freshwater | NRFPRRVRIHGGEFGESARAIHRTELERSDSSRTEEILQFD* |
| Ga0157626_11685251 | 3300012759 | Freshwater | VRIHGGEFGESARAIHRNELERSSSSRIEEIPRFD* |
| Ga0138273_10701471 | 3300012760 | Freshwater Lake | VRIHGGEFGESARAIHRTEVKKLTSSQVQEIPELD* |
| Ga0138273_10814481 | 3300012760 | Freshwater Lake | RIHGGEFGESARAIHRTESEKSDSSRTREILWID* |
| Ga0138273_11576601 | 3300012760 | Freshwater Lake | RIHGGEFGESARAIHRNEVKKLTSSRAGEILSID* |
| Ga0138288_12042121 | 3300012761 | Freshwater Lake | QINRFPRRVRIHGGEFGESARAIHRNEVKKLTSSQDQEIPVLD* |
| Ga0157554_10948771 | 3300012762 | Freshwater | NRFPRRVRIHGGEFGESARAIHRNESERSGSSRDREIPELD* |
| Ga0157554_11352921 | 3300012762 | Freshwater | RVRIHGGEFGESARAIHRTELEKSGSSRDREILELD* |
| Ga0157554_11930681 | 3300012762 | Freshwater | VRIHGGEFGESARAIHRNEPERSGSSRIGEIPRFD* |
| Ga0138289_11571121 | 3300012763 | Freshwater Lake | VRIHGGEFGESARAIHRNESEKSDSSRIKEIPWFD* |
| Ga0157624_10061282 | 3300012764 | Freshwater | VRIHGGEFGESARAIHRIESERSDSSREREILDLD* |
| Ga0157624_11635532 | 3300012764 | Freshwater | QKLNRFPRRVRIHGGEFGESARAIHRTESEKSDSSRDREILDLD* |
| Ga0138282_10971591 | 3300012766 | Freshwater Lake | VRIHGGEFGESARAIHRTETEKSVSSRAMDRPWFD* |
| Ga0138282_11627862 | 3300012766 | Freshwater Lake | VRIHGGEFGESARAIHRTELERSSSSRIGEIPRFD* |
| Ga0138282_11938161 | 3300012766 | Freshwater Lake | VRIHGGEFGESARAIHRTELEKSGSSRIGEIPPFD* |
| Ga0138282_12356791 | 3300012766 | Freshwater Lake | VRIHGGEFGESARAIHRTESERSDSSRTEEILQFD* |
| Ga0138276_10906931 | 3300012768 | Freshwater Lake | VRIHGGEFGESARAIHRTETKKLVSSQVQEIPELD* |
| Ga0138276_10988241 | 3300012768 | Freshwater Lake | VRIHGGEFGESARAIHRTESEKSDSSRTGEILSLD* |
| Ga0138276_11406181 | 3300012768 | Freshwater Lake | VRIHGGEFGESARAIHRNELEKSGSSRIGEIPRFD* |
| Ga0138276_11455931 | 3300012768 | Freshwater Lake | RIHDGEFGESARAIHRTGSKKLDPSRTTDSPWID* |
| Ga0138276_11554931 | 3300012768 | Freshwater Lake | DRIHGGEFGESARAIHRTESEKSDSSRTREILSID* |
| Ga0138276_12470591 | 3300012768 | Freshwater Lake | RIHGGEFGESARAIHRTEVKNFNFSRTREILSID* |
| Ga0138276_12473781 | 3300012768 | Freshwater Lake | NRFPRRVRIHGGEFGESARAIHRNEVKKLTSSRAGEILSID* |
| Ga0138279_10978481 | 3300012769 | Freshwater Lake | VRIHGGEFGESARAIHRTEPEKSGLSRGREIPELD* |
| Ga0138279_10999201 | 3300012769 | Freshwater Lake | VRIHDGEFGESARAIHRTGSKKLDPSRTTDSPWID* |
| Ga0138279_12636451 | 3300012769 | Freshwater Lake | RIHGGEFGESARAIHRTESEKSDSSRTREILWLD* |
| Ga0138291_12543702 | 3300012770 | Freshwater Lake | VRIHGGEFGESARAIHRTEVKKLTSSRTGEILSID* |
| Ga0138287_10295812 | 3300012772 | Freshwater Lake | RIHGGEFGESARAIHRNEPEKSGSSRIEEIPRFD* |
| Ga0138287_10830432 | 3300012772 | Freshwater Lake | RIHGGEFGESARAIHRNELERSSSSRDREIPELD* |
| Ga0138290_10495322 | 3300012773 | Freshwater Lake | VRIHGGEFGESARAIHRTESEQSGSSRIGEIPRFD* |
| Ga0138290_10781722 | 3300012773 | Freshwater Lake | VRIHGGEFGESARAIHRNESEKSGSSRVLEIPELD* |
| Ga0138290_10814321 | 3300012773 | Freshwater Lake | VRIHGGEFGESARAIHRTESEKSGSSRTREILSID* |
| Ga0138290_12374451 | 3300012773 | Freshwater Lake | RVRIHGGEFGESARAIHRTEVKKLTSSRTGEILSID* |
| Ga0138290_12382732 | 3300012773 | Freshwater Lake | RVRIHGGEFGESARAIHRNEVKKLTSSRAREILSID* |
| Ga0138290_12395892 | 3300012773 | Freshwater Lake | RVRIHGGEFGESARAIHRNEVKKLTSSQDQEIPVLD* |
| Ga0138283_10179191 | 3300012774 | Freshwater Lake | RIHGGEFGESARAIHRNEVKKLTSSQDQEIPVLD* |
| Ga0138283_10884002 | 3300012774 | Freshwater Lake | RVRIHGGEFGESARAIHRTESEKSDSSRTGEILSVD* |
| Ga0138283_10930921 | 3300012774 | Freshwater Lake | RVRIHGGEFGESARAIHRTESEKSDSSRTGEILSID* |
| Ga0138283_11119301 | 3300012774 | Freshwater Lake | VRIHGGEFGESARAIHRTESEKSGSSRAREILELD* |
| Ga0138283_11208632 | 3300012774 | Freshwater Lake | VRIHGGEFGESARAIHRNESEKSGSSRDREILELD* |
| Ga0138283_11428872 | 3300012774 | Freshwater Lake | VRIHGGEFGESARAIHRIESEESGSSRDREILELD* |
| Ga0138283_12098661 | 3300012774 | Freshwater Lake | INRFPRRVRIHGGEFGESARAIHRTETEKSVSSRIMDRP* |
| Ga0138283_12355741 | 3300012774 | Freshwater Lake | VRIHGGEFGESARAIHRNESEESGSSRIGEIPRFD* |
| Ga0138280_11616152 | 3300012775 | Freshwater Lake | RIHGGDFGESARAIHRTEVKKLTSSRAGEILSID* |
| Ga0138275_13381431 | 3300012776 | Freshwater Lake | VRIHGGEFGESARAIHRTEVKKLTSSQVQEIPDLD* |
| Ga0138292_10408241 | 3300012777 | Freshwater Lake | RIHGGEFGESARAIHRNELAKSGSSRIGEILRFD* |
| Ga0138292_11889901 | 3300012777 | Freshwater Lake | RVRIHGGEFGESARAIHRTESEKSGSSRIGEIPRFD* |
| Ga0138292_12276372 | 3300012777 | Freshwater Lake | VRIHGGEFGESARAIHRNETEKSVSSRIGEIPRFD* |
| Ga0138292_12931251 | 3300012777 | Freshwater Lake | VRIHGGEFGESARAIHRIESEKSDSSREREILELD* |
| Ga0138292_13164152 | 3300012777 | Freshwater Lake | VRIHGGEFGESARAIHRNEPEKSGSSRVLEIPELD* |
| Ga0138284_11940731 | 3300012779 | Freshwater Lake | KQINRFPRRVRIHGGEFGESARAIHRTELEKSGSSRDREILELD* |
| Ga0138284_14117691 | 3300012779 | Freshwater Lake | VRIHGGEFGESARAIHQNEVKKLTSSQDQEIPVLD* |
| Ga0138286_10648801 | 3300012781 | Freshwater Lake | INRFPRRVRIHGGEFGESARAIHRTESEKSDSSRVREILELD* |
| Ga0138286_10685821 | 3300012781 | Freshwater Lake | INRFPRRVRIHGGEFGESARAIHRNELERSSSSRDREIPELD* |
| Ga0157524_1544732 | 3300012783 | Freshwater | RRVRIHGGEFGESARAIHRNEPEKSGSSRVLEIPKLD* |
| Ga0157620_10326272 | 3300012959 | Freshwater | VRIHGGEFGESARAIHRIESEQSGSSRIGEIPRFD* |
| Ga0129337_12078271 | 3300012968 | Aqueous | RIHGGEFGESARAIHRIELERSSSSRIGEIPQFD* |
| Ga0129337_13086311 | 3300012968 | Aqueous | RVRIHGGEFGESARAIHRTEVKKLTSSREREIPGLD* |
| Ga0129338_10137391 | 3300012970 | Aqueous | VRIHGGEFGESARAIHRNESEQSDSSQDWEIPGLD* |
| Ga0129338_10704322 | 3300012970 | Aqueous | RIHGGEFGESARAIHQIESEKSGSSREQEIPGLD* |
| Ga0129338_11287231 | 3300012970 | Aqueous | RRVRIHGGEFGESARAIHRIESEQSGSSRIGEIPRFD* |
| Ga0129338_11808402 | 3300012970 | Aqueous | RIHGGEFGESARAIHRIEVKKLTSSRTGEILSID* |
| Ga0129338_11819212 | 3300012970 | Aqueous | RIHGGEFGESARAIHRIEPEKSGSSRIGEIPRFD* |
| Ga0129338_11885592 | 3300012970 | Aqueous | RIHGGEFGESARAIHRTELEQSSSSRIGEIPRFD* |
| Ga0129338_13570412 | 3300012970 | Aqueous | VRIHGGEFGESARAIHRIESERSGSSRGQEIPDLD* |
| Ga0129338_14114431 | 3300012970 | Aqueous | VRIHGGEFGESARAIHRTEVKKLTSSREREIPGLD* |
| Ga0129338_14128551 | 3300012970 | Aqueous | VRIHGGEFGESARAIHRTEVKKLTSSRTREILSID* |
| Ga0159060_10069181 | 3300012990 | Hydrocarbon Resource Environments | VNRFPRRVRIHGGEFGESARAIHRIESEKSDSSRIGEIPRFD* |
| Ga0164293_100689302 | 3300013004 | Freshwater | NRFPRRVRIHGGEFGESARAIHRTESEKSDSSQGWEIPNLD* |
| Ga0164294_100765411 | 3300013006 | Freshwater | INRFPRRVRIHGGEFGESARAIHRTELEKSGSSRDREILELD* |
| Ga0164294_102763371 | 3300013006 | Freshwater | KNRFPRRVRIHGGEFGESARAIHRNESERSGSSRDREIPELD* |
| Ga0170791_100880182 | 3300013295 | Freshwater | PRRVRIHGGEFGESARAIHRIESEKSDSSREREILELD* |
| Ga0170791_107239822 | 3300013295 | Freshwater | RRVRIHGGEFGESARAIHRTELEKSGSSRIGEIPPFD* |
| Ga0170791_130351721 | 3300013295 | Freshwater | RVRIHGGEFGESARAIHRTESEKSDSSRTREILWID* |
| Ga0170791_140103901 | 3300013295 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRDWEIPKLD* |
| Ga0170791_150885351 | 3300013295 | Freshwater | RVRIHGGEFGESARAIHRTELERSSSSRIGEIPRFD* |
| Ga0170791_153088241 | 3300013295 | Freshwater | RIHGGEFGESARAIHRNELEKSGSSRIWEIPRFD* |
| Ga0170791_161816691 | 3300013295 | Freshwater | RVRIHGGEFGESARAIHRTESEKSDSSRTREILSID* |
| Ga0157622_10659192 | 3300013310 | Freshwater | RRVRIHGGEFGESARAIHRIESERSGSSRIGEIPRFD* |
| Ga0157622_11796751 | 3300013310 | Freshwater | QINRFPRRVRIHGGEFGESARAIHRIELERSSSSRIEEIPQFD* |
| Ga0180041_1234382 | 3300015243 | Freshwater | VRIHGGEFGESARAIHRIESEQSGSSRGQEIPGLD* |
| Ga0180041_1377501 | 3300015243 | Freshwater | NRFPRRVRIHGGEFGESARAIHRIESEKSGSSRIGEIPRFD* |
| Ga0180041_1548142 | 3300015243 | Freshwater | FPRRVRIHGGEFGESARAIHRIELERSSSSRIEEIPQFD* |
| Ga0180043_1191051 | 3300016681 | Freshwater | QINRFPRRVRIHGGEFGESARAIHRIESEKSGSSRDREILELD |
| Ga0180043_1224452 | 3300016681 | Freshwater | RVRIHGGEFGESARAIHRTESEKSGSSRIGEIPRFD |
| Ga0180043_1812391 | 3300016681 | Freshwater | QINRFPYRVRIHGGEFGESARAIHRTESERSGSSRIGEIPRFD |
| Ga0180043_1878191 | 3300016681 | Freshwater | RVRIHGGEFGESARAIHRIELERSSSSRIEEIPQFD |
| Ga0180042_1351612 | 3300016683 | Freshwater | RVRIHGGEFGESARAIHRIESEKSGSSRDREILELD |
| Ga0180042_1521541 | 3300016683 | Freshwater | VRIHGGEFGESARAIHRIELERSSSSRIEEIPQFD |
| Ga0180048_10113812 | 3300016690 | Freshwater | VRIHGGEFGESARAIHRNESERSGSSRDREIPELD |
| Ga0180048_11246661 | 3300016690 | Freshwater | RVRIHGGEFGESARAIHRNESEKSDSSRVREIPELD |
| Ga0180038_11824952 | 3300016693 | Freshwater | VRIHGGEFGESARAIHRTELEKSGSSRDREILELD |
| Ga0180051_10350251 | 3300016694 | Freshwater | VRIHGGEFGESARAIHRTELEKSGSSRIKEIPWFD |
| Ga0180051_10583261 | 3300016694 | Freshwater | RRVRIHGGEFGESARAIHRTESEKSGSSRDREILELD |
| Ga0180051_11814041 | 3300016694 | Freshwater | NRFPRRVRIHGGEFGESARAIHRNESEKSDSSRVREIPELD |
| Ga0180057_10293291 | 3300016697 | Freshwater | VRIHGGEFGESACAIHRMESEKSGSSRGREVPELD |
| Ga0180057_10519372 | 3300016697 | Freshwater | VRIHGGEFGESARAIHRIESERSDSSREREILDLD |
| Ga0180057_11549842 | 3300016697 | Freshwater | VRIHGGEFGESARAIHRIELERSSSSRIEEILQFD |
| Ga0180057_11718371 | 3300016697 | Freshwater | INRFPRRVRIHGGEFGESARAIHRIESEKSGSSRDREILELD |
| Ga0180058_10975191 | 3300016699 | Freshwater | INRFPRRVRIHGGEFGESARAIHRIELERSSSSRIEEIPQFD |
| Ga0180058_11288502 | 3300016699 | Freshwater | GKQLNRFPRRVRIRGGEFGESARAIHRTESEKSDSSQD |
| Ga0180058_12066882 | 3300016699 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRDREILVLD |
| Ga0180058_12285221 | 3300016699 | Freshwater | VRIHGGEFGESARAIHRTEPEKSGSSRDREILELD |
| Ga0188878_10303691 | 3300019114 | Freshwater Lake | VRIHGGEFGESARAIHRIELERSSSSRIGEIPRFD |
| Ga0180036_10838962 | 3300019200 | Estuarine | VRIHGGEFGESARAIHRTESEKSDSSRAGEILSID |
| Ga0180036_10844461 | 3300019200 | Estuarine | VRIHGGEFGESARAIHRTESEKSDSSREWEIPKLD |
| Ga0180032_10312642 | 3300019201 | Estuarine | VRIHGGEFGESARAIHRTESEKSDSSRVWEIPELD |
| Ga0180032_10357972 | 3300019201 | Estuarine | VRIHGGEFGESARAIHRTESEKSDSSRTGEILSID |
| Ga0180032_10455812 | 3300019201 | Estuarine | VRIHGGEFGESARAIHRIESERSGSGRIEDIPWFD |
| Ga0180032_10753192 | 3300019201 | Estuarine | VRIHGGEFGESARAIHRIELEKSNSSRVREILELD |
| Ga0180032_11659882 | 3300019201 | Estuarine | RVRIHGGEFGESARAIHRTESEKSDSSREWEIPSLD |
| Ga0211731_100769301 | 3300020205 | Freshwater | PRRVRIHGGEFGESARAIHRTESEKSDSSRFREILELD |
| Ga0210303_10036482 | 3300021282 | Estuarine | VRIHGGEFGESARAIHRIESEKSGSSRIGEIPRFD |
| Ga0210303_10042191 | 3300021282 | Estuarine | VRIHGGEFGESARAIHRNESERSGSSRGREILELD |
| Ga0194043_10499501 | 3300021473 | Anoxic Zone Freshwater | TKNRFPHRVRIHGGEFGESARAIHRKRVKKLTQSRDREIPELD |
| Ga0210304_10071241 | 3300021849 | Estuarine | RVRIHGGEFGESARAIHRNESEKSGSSRIGEIPRFD |
| Ga0210304_10169801 | 3300021849 | Estuarine | VRIHGGEFGESARAIHRTESEKSDSSRTREILSFD |
| Ga0213934_10013842 | 3300022156 | Freshwater | VRIHGGEFGESARAIHRIELEKSGSSRIEEIPRFD |
| Ga0213934_10016092 | 3300022156 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSRLGEIPSID |
| Ga0213934_10034262 | 3300022156 | Freshwater | VRIHGGEFGESARAIHRIEPERSGSSRIGEIPRFD |
| Ga0213934_10060601 | 3300022156 | Freshwater | VRIHGGEFGESARAIHRIELEKSGSSREREILELD |
| Ga0213934_10069551 | 3300022156 | Freshwater | VRIHGGEFGESARAIHRIESERSGSSRIGEIPRFD |
| Ga0213934_10112681 | 3300022156 | Freshwater | QINRFPRRVRIHGGEFGESARAIHRIELEKSGSSRIGEIPRFD |
| Ga0213932_10025192 | 3300022166 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSRIEEIPRFD |
| Ga0213932_10714412 | 3300022166 | Freshwater | VRIHGGEFGESARAIHRIELEKSSSSRIGEIPRFD |
| Ga0210311_10485871 | 3300022374 | Estuarine | VRIHGGEFGESARAIHRTEVKKLTSSREWEIPNLD |
| Ga0210313_10195522 | 3300022375 | Estuarine | VRIHGGEFGESARAIHRTESEKSDSSREWEIPSLD |
| Ga0210313_10433212 | 3300022375 | Estuarine | VRIHGGEFGESARAIHRNELERSSSSRDREIPELD |
| Ga0214921_100215821 | 3300023174 | Freshwater | NRFPDRVRIHGGEFGESARAIHRTELEKSGSSRIGEIPRFD |
| Ga0214919_102482812 | 3300023184 | Freshwater | PDRVRIHGGEFGESARAIHRTELEKSGSSRIGEIPRFD |
| Ga0228709_10042772 | 3300023708 | Freshwater | VRIHGGEFGESARAIHRIELEKSGSSRIGEIPRFD |
| Ga0228709_10466772 | 3300023708 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSRIGEIPQFD |
| Ga0255223_10017321 | 3300024480 | Freshwater | RVRIHGGEFGESARAIHRTEVKKLTSSREWEIPNLD |
| Ga0255223_10127272 | 3300024480 | Freshwater | VRIHGGEFGESARAIHRNESEKSGSSRVREILELD |
| Ga0255224_10025331 | 3300024483 | Freshwater | RVRIHGGEFGESARAIHRTEVKKLTSSREWEIPKLD |
| Ga0255224_10313601 | 3300024483 | Freshwater | RVRIHGGEFGESARAIHRNESEKSDSSRMREILSFD |
| Ga0256318_10044201 | 3300024485 | Freshwater | INRFPRRVRIHGGEFGESARAIHRIELERSSSSRIGEIPRFD |
| Ga0256318_10445551 | 3300024485 | Freshwater | KNRFPRRVRIHGGEFGESARAIHRTESEKSDSSRTGEILSID |
| Ga0255222_10052231 | 3300024487 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRVREILELD |
| Ga0256322_10427372 | 3300024530 | Freshwater | FPRRVRIHGGEFGESARAIHRIESEKSGSSRDREILELD |
| Ga0256357_10319042 | 3300024534 | Freshwater | FPRRVRIHGGEFGESARAIHRTESEKSDSSRTGEIPSID |
| Ga0256357_10405311 | 3300024534 | Freshwater | VRIHGGEFGESARAIHRIEVKKLTSSREWEIPILD |
| Ga0255303_10262141 | 3300024535 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRTGEIPSID |
| Ga0255225_10015081 | 3300024537 | Freshwater | NRFPRRVRIHGGEFGESARAIHRTESEKSDSSRTREILSID |
| Ga0255225_10160422 | 3300024537 | Freshwater | RRVRIHGGEFGESARAIHRNESEKSGSSRVREILELD |
| Ga0255231_10011822 | 3300024539 | Freshwater | VRIRGGEFGESARAIHRTESEKSDSSQGQEIPGLD |
| Ga0255231_10262251 | 3300024539 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRTREILWID |
| Ga0255231_10571112 | 3300024539 | Freshwater | RVRIHDGEFGESARAIHRNESEKSDSSRMREILSFD |
| Ga0256350_10295271 | 3300024542 | Freshwater | RFPRRVRIHGGEFGESARAIHRIESEKSGSSRIGEIPRFD |
| Ga0256348_10055942 | 3300024543 | Freshwater | FPRRVRIHGGEFGESARAIHRIEVKKLTSSREWEIPILD |
| Ga0256356_10084051 | 3300024546 | Freshwater | RRVRIHGGEFGESARAIHRNESEKSGSSRTREILSID |
| Ga0256356_10163721 | 3300024546 | Freshwater | FPCRVRIHGGEFGQSARAIHRIESEKSGSSRIGEIPRFD |
| Ga0256308_10051972 | 3300024549 | Freshwater | VRIHGGEFGESARAIHRTEVKKLTSSREWEIPKLD |
| Ga0256308_10059791 | 3300024549 | Freshwater | LKNRFPDRVRIHGGEFGESARAIHRTEVKKLTSSQVQEIPQLD |
| Ga0255242_10069281 | 3300024554 | Freshwater | RVRIHGGEFGESARAIHRTESEKSDSSRTREILWID |
| Ga0255232_10029631 | 3300024558 | Freshwater | TTKNRFPRRVRIHGGEFGESARAIHRTEVKKLTSSREWEIPKLD |
| Ga0255232_10563522 | 3300024558 | Freshwater | VRIHGGEFGESARAIHRTEVKKLTSSQVQEIPQLD |
| Ga0256306_10076592 | 3300024560 | Freshwater | RVRIHGGEFGESARAIHRNESEKSGSSRDWEIPELD |
| Ga0255237_10255552 | 3300024564 | Freshwater | VRIHGGEFGESARAIHRIESEKSDSSREREIPELD |
| Ga0256309_11404121 | 3300024566 | Freshwater | RVRIHGGEFGESARAIHRTESEKSDSSRTREILSID |
| Ga0256307_10067221 | 3300024567 | Freshwater | RFPRRVRIHGGEFGESARAIHRTEVKKLTSSREWEIPKLD |
| Ga0255243_10101601 | 3300024569 | Freshwater | QINRFPRRVRIHGGEFGESARAIHRTESEKSDSSRVWEILELD |
| Ga0256302_10044522 | 3300024571 | Freshwater | RVRIHGGEFGESARAIHRNESEKSGSSRVREILELD |
| Ga0256302_11027512 | 3300024571 | Freshwater | RVRIHGGEFGESARAIHRIELERSSSSRIGEIPRFD |
| Ga0255229_10018901 | 3300024848 | Freshwater | VRIRGGEFGESARAIHRTESEESDSSQGQEIPGLD |
| Ga0255229_10059872 | 3300024848 | Freshwater | FPRRVRIHGGEFGESARAIHRIESEKSGSSRIGEIPRFD |
| Ga0255229_10190151 | 3300024848 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSRVREILELD |
| Ga0255230_10026931 | 3300024849 | Freshwater | RVRIHGGEFGESARAIHRTEVKKLTSSQVQEIPQLD |
| Ga0255230_10279391 | 3300024849 | Freshwater | NRFPRRVRIHGGEFGESARAIHRIESERSGSSRIEEIP |
| Ga0255293_10675612 | 3300024851 | Freshwater | VRIHGGEFGESARAIHRIEVKKLTSSRDWEIPSLD |
| Ga0256304_10669901 | 3300024856 | Freshwater | QINRFPRRVRIHGGEFGESARAIHRNESERSGSSRGREILELD |
| Ga0256312_10028301 | 3300024861 | Freshwater | VRIHGGEFGESARAIHRNESEKSGSSRDREILELD |
| Ga0255246_10048252 | 3300024863 | Freshwater | VRIHGGEFGESARAIHRTESEKSDLSRTREILWID |
| Ga0255246_10087122 | 3300024863 | Freshwater | TKNRFPRRVRIHGGEFGESARAIHRIEVKKLTSSQDQEIPDLD |
| Ga0255246_11042061 | 3300024863 | Freshwater | NRFPRRVRIHGGEFGESARAIHRNESERSGSSRGREILELD |
| Ga0255246_11060951 | 3300024863 | Freshwater | KQINRFPRRVRIHGGEFGESARAIHRIESEKSGSSRDREILELD |
| Ga0255248_10014052 | 3300025742 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSRIKEIPWFD |
| Ga0255248_10034362 | 3300025742 | Freshwater | VRIHGGEFGESARAIHRTELERSSSSRIEEIPRFD |
| Ga0255248_10082471 | 3300025742 | Freshwater | VRIHGGEFGESARAIHRTELERSSSSRIGEIPRFD |
| Ga0255248_10363981 | 3300025742 | Freshwater | VRIHGGEFGESARAIHRTESEESDSSRDWEILELD |
| Ga0255245_10351101 | 3300025744 | Freshwater | VRIHGGEFGESARAIHRIELERSSSSRIEEMPRFD |
| Ga0255244_10048481 | 3300025745 | Freshwater | VRIHGGEFGESARAIHRNESEKSDSSRVKEIPWFD |
| Ga0255244_10059561 | 3300025745 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRSREILSID |
| Ga0255241_10494842 | 3300025746 | Freshwater | VRIHGGEFGESARAIHRNESEKSGLSRIKEIPWFD |
| Ga0255247_10031471 | 3300025747 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSREREIPELD |
| Ga0256314_10011011 | 3300025749 | Freshwater | VRIHGGEFGESARAIHRTESEKSGSSRDREILELD |
| Ga0256314_10423622 | 3300025749 | Freshwater | VRIHGGEFGESARAIHRNESEKSDSSRDWEIPKLD |
| Ga0255235_10018411 | 3300025753 | Freshwater | VRIHGGEFGESARAIHRNESEKSGSSRDWEIPELD |
| Ga0255235_10117412 | 3300025753 | Freshwater | RVRIHGGEFGESARAIHRTESEKSDSSREWEIPNLD |
| Ga0255239_10214492 | 3300025756 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRVWEILELD |
| Ga0255239_10644062 | 3300025756 | Freshwater | VRIHGGEFGESARAIHRIESERSDSSRVREIPKLD |
| Ga0256313_10012242 | 3300025757 | Freshwater | VRIHGGEFGESARAIHRIESERSDSSRIGEIPRFD |
| Ga0256313_10123901 | 3300025757 | Freshwater | RFPRRVRIHGGEFGESARAIHRTESEKFDSSRDREILELD |
| Ga0256313_10206521 | 3300025757 | Freshwater | RFPRRVRIQGGEFGESARAIHRNESEKSGSSRDREILELD |
| Ga0256313_10745842 | 3300025757 | Freshwater | FPRRVRIHGGEFGESARAIHRTESEKSGSSRIGEIPRFD |
| Ga0255249_10019071 | 3300025760 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRDREILELD |
| Ga0255249_10028601 | 3300025760 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSREREIPDLD |
| Ga0255249_10039542 | 3300025760 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSRDREILELD |
| Ga0255249_10302642 | 3300025760 | Freshwater | VRIHGGEFGESARAIHRIELERSNSSRGREILELD |
| Ga0255249_10406871 | 3300025760 | Freshwater | VRIHGGEFGESARAIHRTEVKKLTSSRTREILWFD |
| Ga0255249_10500001 | 3300025760 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRIGEIPRFD |
| Ga0255250_10270472 | 3300025763 | Freshwater | VRIHGGEFGESARAIHRTESEKSGSSRIKEIPWFD |
| Ga0255250_10677732 | 3300025763 | Freshwater | VRIHGGEFGESARAIHRTESERSDSSRTEEILQFD |
| Ga0256326_10287812 | 3300026412 | Freshwater | VRIRGGEFGESARAIHRTESERSDSSRVWEIPELD |
| Ga0256326_10445122 | 3300026412 | Freshwater | VRIHGGEFGESARAIHRTESEKSGSSRIGEIPRFD |
| Ga0256298_10167452 | 3300026415 | Freshwater | VRIHGGEFGESARAIHRIESEKSDSSRDREILELD |
| Ga0256298_10607042 | 3300026415 | Freshwater | VRIHGGEFGESARAIHRTEVKKLTSSRAGEILSID |
| Ga0256300_10012831 | 3300026425 | Freshwater | RVRIHGGEFGESARAIHRTESEKSDSSRTGEILSID |
| Ga0256300_10028882 | 3300026425 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSRAREILELD |
| Ga0256300_10084131 | 3300026425 | Freshwater | VRIHGGEFDESARAIHQNEMEKSSSSRVREILGLD |
| Ga0256300_10085842 | 3300026425 | Freshwater | VRIHGGEFGESARAIHRTESEKSDSSREWEIPNLD |
| Ga0256300_10512311 | 3300026425 | Freshwater | VRIHGGEFGESARAIHRNESEKSDSSRMREILSFD |
| Ga0255253_10026522 | 3300026429 | Freshwater | VRIHGGEFGESARAIHRTESEKFDSSRDREILELD |
| Ga0255253_10491502 | 3300026429 | Freshwater | RVRIHGGEFGESARAIHRTELERSSSSRIEEIPRFD |
| Ga0255253_10615802 | 3300026429 | Freshwater | VRIHGGEFGESARAIHRNESEKSDSSRGREIPELD |
| Ga0256297_10010471 | 3300026435 | Freshwater | VRIHGGEFGESARAIHRIESEKSDSSRIGEIPRFD |
| Ga0256297_10331412 | 3300026435 | Freshwater | VRIHGGEFGESARAIHRNESEKSGSSRIGEIPRFD |
| Ga0256319_10029732 | 3300026454 | Freshwater | RVRIHGGEFGESARAIHRIESERSDSSRIGEIPRFD |
| Ga0256319_10325251 | 3300026454 | Freshwater | RVRIHGGEFGESARAIHRTESEKSGSSRIEEIPRFD |
| Ga0256311_10113362 | 3300026565 | Freshwater | NRFPRRVRIHGGEFGESARAIHRTESEKSDSSRVWEILELD |
| Ga0256303_10871281 | 3300026567 | Freshwater | VRIHGGEFGESARAIHRTEVKRLTSSREREIPGLD |
| Ga0208788_10841262 | 3300027499 | Deep Subsurface | RRVRIHGGEFGESARAIHRIELERSSSSRIGEIPRFD |
| Ga0208682_10295611 | 3300027531 | Estuarine | RVRIHDGEFGESARAIHRNELEKSDSSRMREILSFD |
| Ga0209769_11670401 | 3300027679 | Freshwater Lake | RVRIHGGEFDESARAIHRIESEKSGSSRGREIPELD |
| Ga0209297_12902852 | 3300027733 | Freshwater Lake | VRIHGGEFGESARAIHRTESEKSDSSRTREILSID |
| Ga0209550_100669202 | 3300027892 | Freshwater Lake | NRFPRRVRIHGGEFGESARAIHRNESEKSDSSRDREILELD |
| Ga0209550_100679641 | 3300027892 | Freshwater Lake | NRFPRRVRIHGGEFGESARAIHRTESEKSDSSRDREILELD |
| Ga0209550_101121842 | 3300027892 | Freshwater Lake | NRFPRRVRIHGGEFGESARAIHRNESERSGSSRVREIPELD |
| Ga0209550_101180361 | 3300027892 | Freshwater Lake | RFPRRVRIHGGEFGESARAIHRTESEKSGSSRIKEIPWFD |
| Ga0209550_103382911 | 3300027892 | Freshwater Lake | RFPRRVRIHGGEFGESARAIHRTESEKSGSSRIGEIPRFD |
| Ga0255259_10214472 | 3300028078 | Freshwater | DRIHGGEFGESARAIHRNESEKSGSSRDREILELD |
| Ga0255259_10406712 | 3300028078 | Freshwater | VRIHGGEFGESARAIHRIELERSSSSRIEEIPRFD |
| Ga0256324_10623192 | 3300028080 | Freshwater | VRIHGGEFGESARAIHRTESEKSGSSRTREILSID |
| Ga0255251_10222872 | 3300028088 | Freshwater | FPRRVRIHGGEFGESARAIHRTESEKFDSSRDREILELD |
| Ga0255299_10398431 | 3300028089 | Freshwater | NRFPRRVRIHGGEFGESARAIHRIESEKSGSSRIEEIPRFD |
| Ga0255261_10676942 | 3300028097 | Freshwater | VRIHGGEFGESARAIHRTESEKSGSSRIEEIPRFD |
| Ga0256349_10506742 | 3300028101 | Freshwater | VRIHGGEFGESARAIHRIESEKSGSSRGREVPELD |
| Ga0256305_10072181 | 3300028108 | Freshwater | INRFPRRVRIHGGEFGESARAIHRNESEKSGSSRDWEIPELD |
| Ga0256305_10750482 | 3300028108 | Freshwater | FPDRVRIHGGEFGESARAIHRIEVKKLTSSREWEIPNLD |
| Ga0255234_10043401 | 3300028113 | Freshwater | NRFPRRVRIHGGEFGESARAIHRIESEKSDSSRIGEIPRFD |
| Ga0255226_10118502 | 3300028255 | Freshwater | VRIHGGEFDESARAIHQNEMEKSSSSRVREILGLG |
| Ga0256316_10420572 | 3300028261 | Freshwater | FPRRVRIHGGEFGESARAIHRTESEKSDSSRDREILELD |
| Ga0256316_10465221 | 3300028261 | Freshwater | RRVRIHGGEFGESARAIHRIELERSSSSRIEEMPRFD |
| Ga0256316_10629591 | 3300028261 | Freshwater | VRIHGGEFGESARAIHRIELEKSGSSRGREILELD |
| Ga0255227_10229511 | 3300028266 | Freshwater | RVSGRGEEIGESARAIHRNESEKSDSSRMREILSFD |
| Ga0255256_10547171 | 3300028271 | Freshwater | VRIHGGEFGESARAIHRIESEKSDSSRIEEIPRFD |
| Ga0210315_10127551 | 3300028329 | Estuarine | VRIHGGEFGESARAIHRTESEKSDSSRTREILWFD |
| (restricted) Ga0247843_11463322 | 3300028569 | Freshwater | RVRIHGGEFGESARAIHRIESEKSGSSRIGEIPRFD |
| (restricted) Ga0247843_12090201 | 3300028569 | Freshwater | PRRVRIHGGEFGESARAIHRIELERSSSSRIGEIPRFD |
| (restricted) Ga0247844_10142315 | 3300028571 | Freshwater | RRVRIHGGEFGESARAIHRNESEKSDSSRIEEIPRFD |
| Ga0256301_10540642 | 3300029697 | Freshwater | VRIHGGEFGESARAIHRIELERFSSSRIGEIPRFD |
| Ga0255233_10025291 | 3300029699 | Freshwater | FPDRVRIHGGEFGESARAIHRTESEKSDSSRTGEILSID |
| Ga0315899_101308021 | 3300031784 | Freshwater | RFPRRVRIHGGEFGESARAIHRIELERSSSSRIGEIPRFD |
| Ga0315905_109848261 | 3300032092 | Freshwater | INRFPRRVRIHGGEFGESARAIHRTELERSSSSRDREILELD |
| Ga0334980_0285007_1_129 | 3300033816 | Freshwater | LNRFPRRVRIHGGEFGESARAIHRIESEKSGSSRIGEIPRFD |
| Ga0334982_0206726_857_967 | 3300033981 | Freshwater | RVRIHGGEFGESARAIHRTEPEKSGSSRDREILELD |
| Ga0335000_0726680_418_540 | 3300034063 | Freshwater | QVNRFPLRVRIHGGEFGESARAIHRIESEKSGSSRIEEIP |
| Ga0335022_0064213_2281_2394 | 3300034095 | Freshwater | RRVRIHGGEFGESARAIHRIGSEKSGSSRIKEIPWFD |
| Ga0335035_0515533_537_650 | 3300034105 | Freshwater | RRVRIHGGEFGESARAIHRTESEKSDSSRTREILWID |
| Ga0335013_0251645_3_134 | 3300034284 | Freshwater | QINRFPRRVRIHGGEFGESARAIHRIELERSSSSRIEEIPQFD |
| ⦗Top⦘ |