| Basic Information | |
|---|---|
| Family ID | F003252 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 497 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRTTARQTRENRTITVDFQNEATYFQLLGDGKAFVECV |
| Number of Associated Samples | 246 |
| Number of Associated Scaffolds | 497 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.51 % |
| % of genes near scaffold ends (potentially truncated) | 75.65 % |
| % of genes from short scaffolds (< 2000 bps) | 89.13 % |
| Associated GOLD sequencing projects | 218 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.855 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.962 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.016 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.101 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.70% β-sheet: 0.00% Coil/Unstructured: 80.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 497 Family Scaffolds |
|---|---|---|
| PF13610 | DDE_Tnp_IS240 | 1.21 |
| PF01526 | DDE_Tnp_Tn3 | 1.01 |
| PF05199 | GMC_oxred_C | 1.01 |
| PF02627 | CMD | 0.80 |
| PF14104 | DUF4277 | 0.80 |
| PF01850 | PIN | 0.80 |
| PF13683 | rve_3 | 0.80 |
| PF03400 | DDE_Tnp_IS1 | 0.80 |
| PF04986 | Y2_Tnp | 0.80 |
| PF00326 | Peptidase_S9 | 0.80 |
| PF01609 | DDE_Tnp_1 | 0.80 |
| PF00589 | Phage_integrase | 0.80 |
| PF13358 | DDE_3 | 0.60 |
| PF03050 | DDE_Tnp_IS66 | 0.60 |
| PF13793 | Pribosyltran_N | 0.60 |
| PF01656 | CbiA | 0.60 |
| PF05685 | Uma2 | 0.60 |
| PF13751 | DDE_Tnp_1_6 | 0.60 |
| PF01436 | NHL | 0.40 |
| PF03795 | YCII | 0.40 |
| PF13586 | DDE_Tnp_1_2 | 0.40 |
| PF13565 | HTH_32 | 0.40 |
| PF00211 | Guanylate_cyc | 0.40 |
| PF04909 | Amidohydro_2 | 0.40 |
| PF12760 | Zn_Tnp_IS1595 | 0.40 |
| PF02518 | HATPase_c | 0.40 |
| PF09339 | HTH_IclR | 0.40 |
| PF01548 | DEDD_Tnp_IS110 | 0.40 |
| PF12759 | HTH_Tnp_IS1 | 0.40 |
| PF01425 | Amidase | 0.40 |
| PF03811 | Zn_Tnp_IS1 | 0.40 |
| PF04851 | ResIII | 0.40 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.40 |
| PF03796 | DnaB_C | 0.40 |
| PF02899 | Phage_int_SAM_1 | 0.40 |
| PF00903 | Glyoxalase | 0.40 |
| PF02922 | CBM_48 | 0.40 |
| PF00239 | Resolvase | 0.40 |
| PF00106 | adh_short | 0.40 |
| PF03743 | TrbI | 0.40 |
| PF04392 | ABC_sub_bind | 0.40 |
| PF05598 | DUF772 | 0.40 |
| PF00665 | rve | 0.40 |
| PF02826 | 2-Hacid_dh_C | 0.40 |
| PF00296 | Bac_luciferase | 0.40 |
| PF12844 | HTH_19 | 0.40 |
| PF05973 | Gp49 | 0.40 |
| PF13083 | KH_4 | 0.40 |
| PF12729 | 4HB_MCP_1 | 0.20 |
| PF08811 | DUF1800 | 0.20 |
| PF00582 | Usp | 0.20 |
| PF14690 | zf-ISL3 | 0.20 |
| PF01979 | Amidohydro_1 | 0.20 |
| PF09852 | DUF2079 | 0.20 |
| PF01522 | Polysacc_deac_1 | 0.20 |
| PF03389 | MobA_MobL | 0.20 |
| PF02371 | Transposase_20 | 0.20 |
| PF13005 | zf-IS66 | 0.20 |
| PF13650 | Asp_protease_2 | 0.20 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.20 |
| PF12762 | DDE_Tnp_IS1595 | 0.20 |
| PF08241 | Methyltransf_11 | 0.20 |
| PF04366 | Ysc84 | 0.20 |
| PF03683 | UPF0175 | 0.20 |
| PF00216 | Bac_DNA_binding | 0.20 |
| PF13411 | MerR_1 | 0.20 |
| PF06411 | HdeA | 0.20 |
| PF01627 | Hpt | 0.20 |
| PF00535 | Glycos_transf_2 | 0.20 |
| PF01402 | RHH_1 | 0.20 |
| PF00011 | HSP20 | 0.20 |
| PF00271 | Helicase_C | 0.20 |
| PF03476 | MOSC_N | 0.20 |
| PF10258 | PHAX_RNA-bd | 0.20 |
| PF03446 | NAD_binding_2 | 0.20 |
| PF00076 | RRM_1 | 0.20 |
| PF02796 | HTH_7 | 0.20 |
| PF07589 | PEP-CTERM | 0.20 |
| PF13700 | DUF4158 | 0.20 |
| PF01799 | Fer2_2 | 0.20 |
| PF06874 | FBPase_2 | 0.20 |
| PF08734 | GYD | 0.20 |
| PF08530 | PepX_C | 0.20 |
| PF00275 | EPSP_synthase | 0.20 |
| PF05977 | MFS_3 | 0.20 |
| PF03167 | UDG | 0.20 |
| PF02615 | Ldh_2 | 0.20 |
| PF08450 | SGL | 0.20 |
| PF00355 | Rieske | 0.20 |
| PF07929 | PRiA4_ORF3 | 0.20 |
| PF13614 | AAA_31 | 0.20 |
| PF01755 | Glyco_transf_25 | 0.20 |
| PF01381 | HTH_3 | 0.20 |
| PF01610 | DDE_Tnp_ISL3 | 0.20 |
| PF13649 | Methyltransf_25 | 0.20 |
| PF00753 | Lactamase_B | 0.20 |
| PF02643 | DUF192 | 0.20 |
| PF13340 | DUF4096 | 0.20 |
| PF04185 | Phosphoesterase | 0.20 |
| PF01051 | Rep_3 | 0.20 |
| PF00496 | SBP_bac_5 | 0.20 |
| PF13359 | DDE_Tnp_4 | 0.20 |
| PF13379 | NMT1_2 | 0.20 |
| PF01724 | DUF29 | 0.20 |
| PF13701 | DDE_Tnp_1_4 | 0.20 |
| PF07978 | NIPSNAP | 0.20 |
| PF03098 | An_peroxidase | 0.20 |
| PF13551 | HTH_29 | 0.20 |
| PF05951 | Peptidase_M15_2 | 0.20 |
| PF13560 | HTH_31 | 0.20 |
| PF10282 | Lactonase | 0.20 |
| PF03009 | GDPD | 0.20 |
| PF09585 | Lin0512_fam | 0.20 |
| COG ID | Name | Functional Category | % Frequency in 497 Family Scaffolds |
|---|---|---|---|
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 1.01 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 1.01 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.80 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.80 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.80 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.80 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.80 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.80 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.60 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.40 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.40 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.40 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.40 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.40 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.40 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.40 |
| COG3677 | Transposase InsA | Mobilome: prophages, transposons [X] | 0.40 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.40 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.40 |
| COG2948 | Type IV secretory pathway, VirB10 component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.40 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.40 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.40 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.40 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.40 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.40 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.40 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.40 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.40 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.20 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.20 |
| COG3855 | Fructose-1,6-bisphosphatase | Carbohydrate transport and metabolism [G] | 0.20 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.20 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.20 |
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.20 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.20 |
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 0.20 |
| COG0507 | ATPase/5’-3’ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.20 |
| COG5527 | Protein involved in initiation of plasmid replication | Mobilome: prophages, transposons [X] | 0.20 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.20 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.20 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.20 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.20 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.20 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.20 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.20 |
| COG1430 | Uncharacterized conserved membrane protein, UPF0127 family | Function unknown [S] | 0.20 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.20 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.20 |
| COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.20 |
| COG3108 | Uncharacterized conserved protein YcbK, DUF882 family | Function unknown [S] | 0.20 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.20 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.20 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.20 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.26 % |
| Unclassified | root | N/A | 23.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_105170926 | Not Available | 603 | Open in IMG/M |
| 3300000955|JGI1027J12803_107566184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1189 | Open in IMG/M |
| 3300000955|JGI1027J12803_108369910 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 1058 | Open in IMG/M |
| 3300000955|JGI1027J12803_108873766 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300000956|JGI10216J12902_100971389 | Not Available | 963 | Open in IMG/M |
| 3300003373|JGI25407J50210_10131122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 617 | Open in IMG/M |
| 3300004268|Ga0066398_10150331 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300004281|Ga0066397_10008799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1241 | Open in IMG/M |
| 3300004463|Ga0063356_102119895 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 854 | Open in IMG/M |
| 3300004633|Ga0066395_10831313 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005187|Ga0066675_10353873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1075 | Open in IMG/M |
| 3300005289|Ga0065704_10535612 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005294|Ga0065705_10565894 | Not Available | 729 | Open in IMG/M |
| 3300005294|Ga0065705_10686403 | Not Available | 659 | Open in IMG/M |
| 3300005295|Ga0065707_10957657 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 550 | Open in IMG/M |
| 3300005332|Ga0066388_101951194 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300005332|Ga0066388_103340278 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005332|Ga0066388_104611227 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005332|Ga0066388_107574124 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 544 | Open in IMG/M |
| 3300005332|Ga0066388_108083304 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 526 | Open in IMG/M |
| 3300005332|Ga0066388_108820363 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 500 | Open in IMG/M |
| 3300005440|Ga0070705_101316783 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005441|Ga0070700_101919943 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 512 | Open in IMG/M |
| 3300005445|Ga0070708_101106976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 742 | Open in IMG/M |
| 3300005447|Ga0066689_10174492 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1291 | Open in IMG/M |
| 3300005467|Ga0070706_100731805 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300005468|Ga0070707_100678946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 993 | Open in IMG/M |
| 3300005471|Ga0070698_101347975 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 664 | Open in IMG/M |
| 3300005536|Ga0070697_100238269 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300005540|Ga0066697_10522635 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005552|Ga0066701_10276631 | Not Available | 1040 | Open in IMG/M |
| 3300005553|Ga0066695_10212670 | Not Available | 1215 | Open in IMG/M |
| 3300005557|Ga0066704_10314502 | Not Available | 1056 | Open in IMG/M |
| 3300005560|Ga0066670_10610472 | Not Available | 664 | Open in IMG/M |
| 3300005577|Ga0068857_100113077 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
| 3300005713|Ga0066905_100431542 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300005713|Ga0066905_101765275 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005719|Ga0068861_102281069 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 543 | Open in IMG/M |
| 3300005764|Ga0066903_101785284 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300005764|Ga0066903_102916899 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300005764|Ga0066903_104980061 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 705 | Open in IMG/M |
| 3300005764|Ga0066903_106359283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 616 | Open in IMG/M |
| 3300005764|Ga0066903_107482141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 564 | Open in IMG/M |
| 3300005764|Ga0066903_107626600 | Not Available | 557 | Open in IMG/M |
| 3300005764|Ga0066903_107798806 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005764|Ga0066903_107847588 | Not Available | 548 | Open in IMG/M |
| 3300005937|Ga0081455_10207276 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300005937|Ga0081455_10939493 | Not Available | 537 | Open in IMG/M |
| 3300005981|Ga0081538_10070181 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1936 | Open in IMG/M |
| 3300005981|Ga0081538_10070418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1931 | Open in IMG/M |
| 3300005983|Ga0081540_1025171 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 3432 | Open in IMG/M |
| 3300005985|Ga0081539_10039788 | All Organisms → cellular organisms → Bacteria | 2769 | Open in IMG/M |
| 3300006032|Ga0066696_10183977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_40CM_4_52_4 | 1324 | Open in IMG/M |
| 3300006194|Ga0075427_10020451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1049 | Open in IMG/M |
| 3300006794|Ga0066658_10040421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1952 | Open in IMG/M |
| 3300006794|Ga0066658_10907700 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 507 | Open in IMG/M |
| 3300006797|Ga0066659_10206979 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300006797|Ga0066659_10667688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300006797|Ga0066659_11215192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300006806|Ga0079220_11945555 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006844|Ga0075428_100084501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3463 | Open in IMG/M |
| 3300006844|Ga0075428_100200567 | Not Available | 2157 | Open in IMG/M |
| 3300006844|Ga0075428_102117567 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 581 | Open in IMG/M |
| 3300006845|Ga0075421_100272505 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
| 3300006845|Ga0075421_101842240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Alcanivoracaceae → Alcanivorax → unclassified Alcanivorax → Alcanivorax sp. | 650 | Open in IMG/M |
| 3300006845|Ga0075421_101894548 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300006846|Ga0075430_100272808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1400 | Open in IMG/M |
| 3300006846|Ga0075430_101221280 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 619 | Open in IMG/M |
| 3300006846|Ga0075430_101560761 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 542 | Open in IMG/M |
| 3300006847|Ga0075431_100215958 | Not Available | 1957 | Open in IMG/M |
| 3300006847|Ga0075431_100335000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1523 | Open in IMG/M |
| 3300006852|Ga0075433_10448957 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1137 | Open in IMG/M |
| 3300006853|Ga0075420_100058409 | All Organisms → cellular organisms → Bacteria | 3423 | Open in IMG/M |
| 3300006853|Ga0075420_100137312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae | 2150 | Open in IMG/M |
| 3300006853|Ga0075420_100175321 | Not Available | 1876 | Open in IMG/M |
| 3300006853|Ga0075420_100270625 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1475 | Open in IMG/M |
| 3300006853|Ga0075420_101096669 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 684 | Open in IMG/M |
| 3300006853|Ga0075420_101476155 | Not Available | 583 | Open in IMG/M |
| 3300006854|Ga0075425_101896967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 668 | Open in IMG/M |
| 3300006871|Ga0075434_100769165 | Not Available | 980 | Open in IMG/M |
| 3300006880|Ga0075429_100091769 | All Organisms → cellular organisms → Bacteria | 2649 | Open in IMG/M |
| 3300006880|Ga0075429_101999280 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006881|Ga0068865_102022827 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 523 | Open in IMG/M |
| 3300006904|Ga0075424_100522254 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1268 | Open in IMG/M |
| 3300006904|Ga0075424_101501208 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 715 | Open in IMG/M |
| 3300006918|Ga0079216_10698068 | Not Available | 722 | Open in IMG/M |
| 3300006969|Ga0075419_10025361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3672 | Open in IMG/M |
| 3300006969|Ga0075419_10181578 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300006969|Ga0075419_10529464 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 821 | Open in IMG/M |
| 3300006969|Ga0075419_11060702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 592 | Open in IMG/M |
| 3300006969|Ga0075419_11301664 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
| 3300007004|Ga0079218_11744319 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300007255|Ga0099791_10465535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 612 | Open in IMG/M |
| 3300007258|Ga0099793_10251266 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300009012|Ga0066710_100821313 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300009012|Ga0066710_101316964 | Not Available | 1120 | Open in IMG/M |
| 3300009012|Ga0066710_103590739 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300009038|Ga0099829_10058554 | All Organisms → cellular organisms → Bacteria | 2881 | Open in IMG/M |
| 3300009038|Ga0099829_10160885 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 1798 | Open in IMG/M |
| 3300009038|Ga0099829_10287942 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300009038|Ga0099829_10663004 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300009038|Ga0099829_10863835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 751 | Open in IMG/M |
| 3300009081|Ga0105098_10060671 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1561 | Open in IMG/M |
| 3300009085|Ga0105103_10815072 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009088|Ga0099830_10500999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales | 991 | Open in IMG/M |
| 3300009088|Ga0099830_10511366 | Not Available | 980 | Open in IMG/M |
| 3300009089|Ga0099828_10034947 | All Organisms → cellular organisms → Bacteria | 4081 | Open in IMG/M |
| 3300009089|Ga0099828_10845185 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300009089|Ga0099828_11883220 | Not Available | 525 | Open in IMG/M |
| 3300009089|Ga0099828_11964524 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 512 | Open in IMG/M |
| 3300009089|Ga0099828_11991515 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009090|Ga0099827_10219983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1586 | Open in IMG/M |
| 3300009090|Ga0099827_10476947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1071 | Open in IMG/M |
| 3300009090|Ga0099827_11299399 | Not Available | 633 | Open in IMG/M |
| 3300009090|Ga0099827_11680587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 553 | Open in IMG/M |
| 3300009090|Ga0099827_11723830 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 546 | Open in IMG/M |
| 3300009090|Ga0099827_11736282 | Not Available | 544 | Open in IMG/M |
| 3300009090|Ga0099827_11920343 | Not Available | 516 | Open in IMG/M |
| 3300009094|Ga0111539_12461465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 604 | Open in IMG/M |
| 3300009100|Ga0075418_10788379 | Not Available | 1026 | Open in IMG/M |
| 3300009100|Ga0075418_11426038 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300009100|Ga0075418_11570441 | Not Available | 714 | Open in IMG/M |
| 3300009100|Ga0075418_11618086 | Not Available | 704 | Open in IMG/M |
| 3300009100|Ga0075418_11816167 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 663 | Open in IMG/M |
| 3300009100|Ga0075418_12653647 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 547 | Open in IMG/M |
| 3300009137|Ga0066709_100337905 | Not Available | 2064 | Open in IMG/M |
| 3300009137|Ga0066709_100756878 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1403 | Open in IMG/M |
| 3300009137|Ga0066709_101036704 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1203 | Open in IMG/M |
| 3300009137|Ga0066709_104105621 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 530 | Open in IMG/M |
| 3300009137|Ga0066709_104493798 | Not Available | 510 | Open in IMG/M |
| 3300009137|Ga0066709_104655477 | Not Available | 502 | Open in IMG/M |
| 3300009143|Ga0099792_10211942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1108 | Open in IMG/M |
| 3300009143|Ga0099792_10747332 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 636 | Open in IMG/M |
| 3300009147|Ga0114129_12547153 | Not Available | 611 | Open in IMG/M |
| 3300009147|Ga0114129_12848795 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300009147|Ga0114129_13000837 | Not Available | 555 | Open in IMG/M |
| 3300009148|Ga0105243_12561010 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 550 | Open in IMG/M |
| 3300009156|Ga0111538_10031396 | All Organisms → cellular organisms → Bacteria | 6882 | Open in IMG/M |
| 3300009156|Ga0111538_10449942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1632 | Open in IMG/M |
| 3300009156|Ga0111538_11278521 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300009156|Ga0111538_12194571 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009156|Ga0111538_12253849 | Not Available | 684 | Open in IMG/M |
| 3300009162|Ga0075423_11017981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 880 | Open in IMG/M |
| 3300009162|Ga0075423_12384171 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 576 | Open in IMG/M |
| 3300009162|Ga0075423_12501007 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 564 | Open in IMG/M |
| 3300009168|Ga0105104_10052318 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
| 3300009168|Ga0105104_10230104 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300009168|Ga0105104_10248455 | Not Available | 971 | Open in IMG/M |
| 3300009176|Ga0105242_10540402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1115 | Open in IMG/M |
| 3300009176|Ga0105242_13053998 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 518 | Open in IMG/M |
| 3300009444|Ga0114945_10886327 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009553|Ga0105249_10623552 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300009553|Ga0105249_10646678 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300009553|Ga0105249_11056107 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300009610|Ga0105340_1539444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 521 | Open in IMG/M |
| 3300009792|Ga0126374_10950410 | Not Available | 670 | Open in IMG/M |
| 3300009792|Ga0126374_11651535 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009806|Ga0105081_1072826 | Not Available | 542 | Open in IMG/M |
| 3300009807|Ga0105061_1005687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1492 | Open in IMG/M |
| 3300009807|Ga0105061_1039092 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 694 | Open in IMG/M |
| 3300009813|Ga0105057_1011631 | Not Available | 1208 | Open in IMG/M |
| 3300009817|Ga0105062_1085019 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009817|Ga0105062_1088565 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 603 | Open in IMG/M |
| 3300009820|Ga0105085_1008419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1763 | Open in IMG/M |
| 3300009820|Ga0105085_1122696 | Not Available | 522 | Open in IMG/M |
| 3300009822|Ga0105066_1028082 | Not Available | 1133 | Open in IMG/M |
| 3300009822|Ga0105066_1156685 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 525 | Open in IMG/M |
| 3300009840|Ga0126313_11044987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300009840|Ga0126313_11462327 | Not Available | 567 | Open in IMG/M |
| 3300010038|Ga0126315_10378462 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 886 | Open in IMG/M |
| 3300010043|Ga0126380_10699982 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300010043|Ga0126380_10766985 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300010043|Ga0126380_11007399 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 702 | Open in IMG/M |
| 3300010043|Ga0126380_11546050 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300010043|Ga0126380_11681691 | Not Available | 569 | Open in IMG/M |
| 3300010043|Ga0126380_12030815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
| 3300010046|Ga0126384_10285572 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300010046|Ga0126384_10319600 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300010046|Ga0126384_10807885 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 840 | Open in IMG/M |
| 3300010046|Ga0126384_11160385 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 711 | Open in IMG/M |
| 3300010046|Ga0126384_11168248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300010046|Ga0126384_11394426 | Not Available | 653 | Open in IMG/M |
| 3300010046|Ga0126384_11431357 | Not Available | 645 | Open in IMG/M |
| 3300010046|Ga0126384_11493139 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 633 | Open in IMG/M |
| 3300010046|Ga0126384_11859990 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010046|Ga0126384_11982882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 556 | Open in IMG/M |
| 3300010046|Ga0126384_12322708 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 518 | Open in IMG/M |
| 3300010047|Ga0126382_10111570 | Not Available | 1792 | Open in IMG/M |
| 3300010047|Ga0126382_10302481 | Not Available | 1202 | Open in IMG/M |
| 3300010047|Ga0126382_10881727 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300010047|Ga0126382_11128884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 697 | Open in IMG/M |
| 3300010047|Ga0126382_11188393 | Not Available | 682 | Open in IMG/M |
| 3300010047|Ga0126382_11417501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 635 | Open in IMG/M |
| 3300010047|Ga0126382_11934638 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 559 | Open in IMG/M |
| 3300010047|Ga0126382_12347994 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010154|Ga0127503_10272280 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 647 | Open in IMG/M |
| 3300010358|Ga0126370_10031338 | Not Available | 3203 | Open in IMG/M |
| 3300010358|Ga0126370_11552287 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 631 | Open in IMG/M |
| 3300010358|Ga0126370_11753937 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010358|Ga0126370_12494486 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 515 | Open in IMG/M |
| 3300010359|Ga0126376_10182900 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300010359|Ga0126376_10714209 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 966 | Open in IMG/M |
| 3300010360|Ga0126372_11806033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 655 | Open in IMG/M |
| 3300010360|Ga0126372_11959471 | Not Available | 632 | Open in IMG/M |
| 3300010360|Ga0126372_12848131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 536 | Open in IMG/M |
| 3300010362|Ga0126377_10248625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1730 | Open in IMG/M |
| 3300010362|Ga0126377_10747252 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1034 | Open in IMG/M |
| 3300010362|Ga0126377_10941921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 928 | Open in IMG/M |
| 3300010362|Ga0126377_11219588 | Not Available | 823 | Open in IMG/M |
| 3300010362|Ga0126377_11598165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum brasilense | 726 | Open in IMG/M |
| 3300010362|Ga0126377_11624469 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 721 | Open in IMG/M |
| 3300010362|Ga0126377_11810221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 686 | Open in IMG/M |
| 3300010362|Ga0126377_11960327 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 662 | Open in IMG/M |
| 3300010362|Ga0126377_13010543 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010362|Ga0126377_13281037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 523 | Open in IMG/M |
| 3300010366|Ga0126379_10452958 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300010366|Ga0126379_10664756 | Not Available | 1133 | Open in IMG/M |
| 3300010366|Ga0126379_12616534 | Not Available | 602 | Open in IMG/M |
| 3300010366|Ga0126379_13785550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 507 | Open in IMG/M |
| 3300010375|Ga0105239_10977770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 973 | Open in IMG/M |
| 3300010398|Ga0126383_10187857 | All Organisms → cellular organisms → Bacteria | 1971 | Open in IMG/M |
| 3300010398|Ga0126383_10734739 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300010398|Ga0126383_10982073 | Not Available | 932 | Open in IMG/M |
| 3300010398|Ga0126383_11329246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 809 | Open in IMG/M |
| 3300010398|Ga0126383_11340918 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300010398|Ga0126383_11507967 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300010398|Ga0126383_12317951 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300010398|Ga0126383_12464374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 605 | Open in IMG/M |
| 3300010398|Ga0126383_12594351 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 590 | Open in IMG/M |
| 3300010400|Ga0134122_11367438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 720 | Open in IMG/M |
| 3300010401|Ga0134121_10733827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 941 | Open in IMG/M |
| 3300011270|Ga0137391_10514305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1012 | Open in IMG/M |
| 3300011271|Ga0137393_11228105 | Not Available | 636 | Open in IMG/M |
| 3300011421|Ga0137462_1044763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 949 | Open in IMG/M |
| 3300011434|Ga0137464_1251978 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012096|Ga0137389_10167089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1813 | Open in IMG/M |
| 3300012096|Ga0137389_10378508 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300012096|Ga0137389_10652702 | Not Available | 904 | Open in IMG/M |
| 3300012189|Ga0137388_11288765 | Not Available | 669 | Open in IMG/M |
| 3300012189|Ga0137388_11562108 | Not Available | 596 | Open in IMG/M |
| 3300012189|Ga0137388_11578362 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 592 | Open in IMG/M |
| 3300012199|Ga0137383_10163337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. PCC 7375 | 1631 | Open in IMG/M |
| 3300012199|Ga0137383_10208909 | Not Available | 1430 | Open in IMG/M |
| 3300012199|Ga0137383_10467547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 924 | Open in IMG/M |
| 3300012199|Ga0137383_10894928 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 648 | Open in IMG/M |
| 3300012199|Ga0137383_11077025 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinales incertae sedis → ANME-2 cluster → unclassified ANME-2 cluster → ANME-2 cluster archaeon | 583 | Open in IMG/M |
| 3300012201|Ga0137365_10405999 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300012202|Ga0137363_10892720 | Not Available | 755 | Open in IMG/M |
| 3300012202|Ga0137363_10903199 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300012202|Ga0137363_11512558 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012203|Ga0137399_10499316 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300012203|Ga0137399_11577518 | Not Available | 544 | Open in IMG/M |
| 3300012205|Ga0137362_10614055 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300012205|Ga0137362_10660325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300012205|Ga0137362_10739382 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300012205|Ga0137362_10962049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 728 | Open in IMG/M |
| 3300012206|Ga0137380_10462373 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300012206|Ga0137380_10604512 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300012207|Ga0137381_10112795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp. | 2315 | Open in IMG/M |
| 3300012207|Ga0137381_11175856 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012209|Ga0137379_10703041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. PCC 7375 | 916 | Open in IMG/M |
| 3300012210|Ga0137378_10063085 | All Organisms → cellular organisms → Bacteria | 3352 | Open in IMG/M |
| 3300012210|Ga0137378_10326854 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1426 | Open in IMG/M |
| 3300012211|Ga0137377_10961207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300012211|Ga0137377_11903123 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 512 | Open in IMG/M |
| 3300012349|Ga0137387_10281148 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300012349|Ga0137387_10845848 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 662 | Open in IMG/M |
| 3300012349|Ga0137387_11140091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 553 | Open in IMG/M |
| 3300012349|Ga0137387_11306870 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 507 | Open in IMG/M |
| 3300012350|Ga0137372_11054211 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012354|Ga0137366_10593154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Acaryochloridaceae → Acaryochloris → unclassified Acaryochloris → Acaryochloris sp. CCMEE 5410 | 795 | Open in IMG/M |
| 3300012355|Ga0137369_10356956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1066 | Open in IMG/M |
| 3300012355|Ga0137369_10661376 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 721 | Open in IMG/M |
| 3300012356|Ga0137371_10537211 | Not Available | 901 | Open in IMG/M |
| 3300012356|Ga0137371_11061564 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 611 | Open in IMG/M |
| 3300012357|Ga0137384_10111740 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
| 3300012358|Ga0137368_10721296 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 624 | Open in IMG/M |
| 3300012359|Ga0137385_10342985 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1279 | Open in IMG/M |
| 3300012359|Ga0137385_10830127 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinales incertae sedis → ANME-2 cluster → unclassified ANME-2 cluster → ANME-2 cluster archaeon | 767 | Open in IMG/M |
| 3300012359|Ga0137385_11096304 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300012361|Ga0137360_10820120 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300012361|Ga0137360_11287922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 631 | Open in IMG/M |
| 3300012361|Ga0137360_11599893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 557 | Open in IMG/M |
| 3300012362|Ga0137361_10344963 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300012362|Ga0137361_10894122 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 806 | Open in IMG/M |
| 3300012362|Ga0137361_11043636 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 738 | Open in IMG/M |
| 3300012362|Ga0137361_11048860 | Not Available | 735 | Open in IMG/M |
| 3300012363|Ga0137390_10957713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 809 | Open in IMG/M |
| 3300012363|Ga0137390_11584388 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 593 | Open in IMG/M |
| 3300012363|Ga0137390_11628890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 582 | Open in IMG/M |
| 3300012469|Ga0150984_118905482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 864 | Open in IMG/M |
| 3300012582|Ga0137358_10464615 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 854 | Open in IMG/M |
| 3300012582|Ga0137358_11071649 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012917|Ga0137395_10368874 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia → Tautonia sociabilis | 1025 | Open in IMG/M |
| 3300012917|Ga0137395_10469175 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300012917|Ga0137395_10609054 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 789 | Open in IMG/M |
| 3300012918|Ga0137396_11002420 | Not Available | 605 | Open in IMG/M |
| 3300012922|Ga0137394_10013955 | All Organisms → cellular organisms → Bacteria | 6343 | Open in IMG/M |
| 3300012922|Ga0137394_10071651 | All Organisms → cellular organisms → Bacteria | 2888 | Open in IMG/M |
| 3300012922|Ga0137394_10239569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1551 | Open in IMG/M |
| 3300012922|Ga0137394_10602495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 929 | Open in IMG/M |
| 3300012922|Ga0137394_10723640 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012922|Ga0137394_11226299 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 614 | Open in IMG/M |
| 3300012922|Ga0137394_11317218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 584 | Open in IMG/M |
| 3300012923|Ga0137359_10867227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300012925|Ga0137419_11766480 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 529 | Open in IMG/M |
| 3300012927|Ga0137416_12101956 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012929|Ga0137404_10001879 | All Organisms → cellular organisms → Bacteria | 13783 | Open in IMG/M |
| 3300012929|Ga0137404_10448751 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300012929|Ga0137404_11321512 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300012930|Ga0137407_10012475 | All Organisms → cellular organisms → Bacteria | 6093 | Open in IMG/M |
| 3300012930|Ga0137407_10030272 | All Organisms → cellular organisms → Bacteria | 4209 | Open in IMG/M |
| 3300012930|Ga0137407_10189167 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300012930|Ga0137407_10306487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1453 | Open in IMG/M |
| 3300012930|Ga0137407_10674192 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300012930|Ga0137407_11967159 | Not Available | 558 | Open in IMG/M |
| 3300012944|Ga0137410_10086709 | All Organisms → cellular organisms → Bacteria | 2299 | Open in IMG/M |
| 3300012948|Ga0126375_10593451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 844 | Open in IMG/M |
| 3300012948|Ga0126375_10623116 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300012948|Ga0126375_10775454 | Not Available | 756 | Open in IMG/M |
| 3300012948|Ga0126375_10814160 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012948|Ga0126375_11132892 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 647 | Open in IMG/M |
| 3300012948|Ga0126375_11339462 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012948|Ga0126375_11699156 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 547 | Open in IMG/M |
| 3300012948|Ga0126375_11789179 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 536 | Open in IMG/M |
| 3300012948|Ga0126375_11807733 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 534 | Open in IMG/M |
| 3300012948|Ga0126375_11818502 | Not Available | 532 | Open in IMG/M |
| 3300012971|Ga0126369_10510917 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1261 | Open in IMG/M |
| 3300012971|Ga0126369_11059858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300012971|Ga0126369_11456838 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 774 | Open in IMG/M |
| 3300012971|Ga0126369_13132191 | Not Available | 542 | Open in IMG/M |
| 3300012971|Ga0126369_13705407 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012988|Ga0164306_10890008 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 725 | Open in IMG/M |
| 3300013215|Ga0118560_101481 | Not Available | 2108 | Open in IMG/M |
| 3300013306|Ga0163162_12613036 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 581 | Open in IMG/M |
| 3300013308|Ga0157375_10597676 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1263 | Open in IMG/M |
| 3300014254|Ga0075312_1076146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300014263|Ga0075324_1121503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300014968|Ga0157379_10433636 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300014968|Ga0157379_11022449 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 789 | Open in IMG/M |
| 3300014968|Ga0157379_12081735 | Not Available | 562 | Open in IMG/M |
| 3300014969|Ga0157376_11935571 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 627 | Open in IMG/M |
| 3300015241|Ga0137418_10588650 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300015241|Ga0137418_10769291 | Not Available | 727 | Open in IMG/M |
| 3300015245|Ga0137409_10121630 | All Organisms → cellular organisms → Bacteria | 2405 | Open in IMG/M |
| 3300015245|Ga0137409_10922784 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300015245|Ga0137409_11225325 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300015264|Ga0137403_10035912 | All Organisms → cellular organisms → Bacteria | 5209 | Open in IMG/M |
| 3300015264|Ga0137403_10059507 | All Organisms → cellular organisms → Bacteria | 3908 | Open in IMG/M |
| 3300015264|Ga0137403_11229888 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → unclassified Gemmata → Gemmata sp. SH-PL17 | 595 | Open in IMG/M |
| 3300015359|Ga0134085_10344989 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300015372|Ga0132256_101254013 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 854 | Open in IMG/M |
| 3300015373|Ga0132257_100115447 | All Organisms → cellular organisms → Bacteria | 3110 | Open in IMG/M |
| 3300015373|Ga0132257_100508773 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300015373|Ga0132257_101142587 | Not Available | 984 | Open in IMG/M |
| 3300015373|Ga0132257_103154259 | Not Available | 600 | Open in IMG/M |
| 3300015373|Ga0132257_103559887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 567 | Open in IMG/M |
| 3300015373|Ga0132257_104005396 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300016270|Ga0182036_10721394 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300016270|Ga0182036_11078114 | Not Available | 664 | Open in IMG/M |
| 3300016294|Ga0182041_11957833 | Not Available | 545 | Open in IMG/M |
| 3300016341|Ga0182035_12156152 | Not Available | 505 | Open in IMG/M |
| 3300016387|Ga0182040_11041777 | Not Available | 683 | Open in IMG/M |
| 3300016422|Ga0182039_10896210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 792 | Open in IMG/M |
| 3300016445|Ga0182038_11365937 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300017997|Ga0184610_1009081 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
| 3300018054|Ga0184621_10175229 | Not Available | 771 | Open in IMG/M |
| 3300018063|Ga0184637_10488446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 718 | Open in IMG/M |
| 3300018071|Ga0184618_10100054 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300018076|Ga0184609_10045444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1859 | Open in IMG/M |
| 3300018076|Ga0184609_10228781 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300018076|Ga0184609_10264552 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 804 | Open in IMG/M |
| 3300018078|Ga0184612_10068353 | Not Available | 1853 | Open in IMG/M |
| 3300018078|Ga0184612_10117479 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1392 | Open in IMG/M |
| 3300018078|Ga0184612_10118425 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300018078|Ga0184612_10466390 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 624 | Open in IMG/M |
| 3300018081|Ga0184625_10164221 | Not Available | 1161 | Open in IMG/M |
| 3300018082|Ga0184639_10265052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 907 | Open in IMG/M |
| 3300018422|Ga0190265_11218348 | Not Available | 871 | Open in IMG/M |
| 3300018433|Ga0066667_11400480 | Not Available | 614 | Open in IMG/M |
| 3300018466|Ga0190268_11647114 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 568 | Open in IMG/M |
| 3300018482|Ga0066669_12057393 | Not Available | 537 | Open in IMG/M |
| 3300019377|Ga0190264_10771549 | Not Available | 725 | Open in IMG/M |
| 3300019789|Ga0137408_1093483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4369 | Open in IMG/M |
| 3300019789|Ga0137408_1235142 | All Organisms → cellular organisms → Bacteria | 3409 | Open in IMG/M |
| 3300019789|Ga0137408_1266937 | Not Available | 4196 | Open in IMG/M |
| 3300019789|Ga0137408_1275697 | Not Available | 1204 | Open in IMG/M |
| 3300019789|Ga0137408_1365414 | All Organisms → cellular organisms → Bacteria | 4058 | Open in IMG/M |
| 3300020170|Ga0179594_10156553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 844 | Open in IMG/M |
| 3300020170|Ga0179594_10226182 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 704 | Open in IMG/M |
| 3300021073|Ga0210378_10146260 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300021081|Ga0210379_10227566 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 807 | Open in IMG/M |
| 3300021086|Ga0179596_10686697 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021560|Ga0126371_11052202 | Not Available | 954 | Open in IMG/M |
| 3300021560|Ga0126371_13284788 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300025796|Ga0210113_1122276 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 507 | Open in IMG/M |
| 3300025917|Ga0207660_11467130 | Not Available | 552 | Open in IMG/M |
| 3300025918|Ga0207662_10421544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 908 | Open in IMG/M |
| 3300025939|Ga0207665_10353627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1109 | Open in IMG/M |
| 3300025961|Ga0207712_11144745 | Not Available | 693 | Open in IMG/M |
| 3300026023|Ga0207677_10240686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1464 | Open in IMG/M |
| 3300026075|Ga0207708_11571707 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300026116|Ga0207674_10051762 | All Organisms → cellular organisms → Bacteria | 4190 | Open in IMG/M |
| 3300026118|Ga0207675_100671950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1043 | Open in IMG/M |
| 3300026325|Ga0209152_10016072 | All Organisms → cellular organisms → Bacteria | 2566 | Open in IMG/M |
| 3300026325|Ga0209152_10492079 | Not Available | 504 | Open in IMG/M |
| 3300026529|Ga0209806_1243524 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300026547|Ga0209156_10186649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 994 | Open in IMG/M |
| 3300026547|Ga0209156_10367783 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 613 | Open in IMG/M |
| 3300026708|Ga0208712_103501 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 592 | Open in IMG/M |
| 3300027379|Ga0209842_1061336 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300027490|Ga0209899_1086521 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 612 | Open in IMG/M |
| 3300027654|Ga0209799_1011187 | Not Available | 1925 | Open in IMG/M |
| 3300027655|Ga0209388_1205816 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 543 | Open in IMG/M |
| 3300027748|Ga0209689_1055876 | All Organisms → cellular organisms → Bacteria | 2188 | Open in IMG/M |
| 3300027748|Ga0209689_1264513 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 690 | Open in IMG/M |
| 3300027873|Ga0209814_10547696 | Not Available | 514 | Open in IMG/M |
| 3300027874|Ga0209465_10429642 | Not Available | 661 | Open in IMG/M |
| 3300027875|Ga0209283_10190572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1362 | Open in IMG/M |
| 3300027880|Ga0209481_10700343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 526 | Open in IMG/M |
| 3300027880|Ga0209481_10761066 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 504 | Open in IMG/M |
| 3300027882|Ga0209590_10024396 | All Organisms → cellular organisms → Bacteria | 3102 | Open in IMG/M |
| 3300027882|Ga0209590_10163230 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300027882|Ga0209590_10198993 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300027882|Ga0209590_10502385 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300027882|Ga0209590_10808151 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 595 | Open in IMG/M |
| 3300027903|Ga0209488_10455834 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300027907|Ga0207428_10124904 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1971 | Open in IMG/M |
| 3300027907|Ga0207428_10129299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1933 | Open in IMG/M |
| 3300027909|Ga0209382_10087441 | All Organisms → cellular organisms → Bacteria | 3665 | Open in IMG/M |
| 3300027909|Ga0209382_10475765 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300028381|Ga0268264_10212649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1776 | Open in IMG/M |
| 3300028381|Ga0268264_12196023 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 560 | Open in IMG/M |
| 3300028381|Ga0268264_12662006 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 504 | Open in IMG/M |
| 3300028819|Ga0307296_10287072 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 897 | Open in IMG/M |
| 3300028878|Ga0307278_10020671 | All Organisms → cellular organisms → Bacteria | 3045 | Open in IMG/M |
| 3300030006|Ga0299907_10287753 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1343 | Open in IMG/M |
| 3300030574|Ga0247648_1098894 | Not Available | 651 | Open in IMG/M |
| 3300030903|Ga0308206_1000887 | All Organisms → cellular organisms → Bacteria | 2686 | Open in IMG/M |
| 3300031054|Ga0102746_10554740 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 511 | Open in IMG/M |
| 3300031093|Ga0308197_10143896 | Not Available | 759 | Open in IMG/M |
| 3300031548|Ga0307408_101877683 | Not Available | 574 | Open in IMG/M |
| 3300031562|Ga0310886_10224957 | Not Available | 1037 | Open in IMG/M |
| 3300031573|Ga0310915_10505372 | Not Available | 859 | Open in IMG/M |
| 3300031573|Ga0310915_10995070 | Not Available | 585 | Open in IMG/M |
| 3300031724|Ga0318500_10538060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 589 | Open in IMG/M |
| 3300031736|Ga0318501_10839934 | Not Available | 510 | Open in IMG/M |
| 3300031740|Ga0307468_100700278 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300031744|Ga0306918_11224376 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300031768|Ga0318509_10849808 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 504 | Open in IMG/M |
| 3300031781|Ga0318547_10236849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1098 | Open in IMG/M |
| 3300031796|Ga0318576_10631699 | Not Available | 504 | Open in IMG/M |
| 3300031820|Ga0307473_10551509 | Not Available | 787 | Open in IMG/M |
| 3300031820|Ga0307473_11463676 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031824|Ga0307413_10140631 | Not Available | 1667 | Open in IMG/M |
| 3300031847|Ga0310907_10224316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 911 | Open in IMG/M |
| 3300031847|Ga0310907_10549940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 623 | Open in IMG/M |
| 3300031852|Ga0307410_10862249 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 774 | Open in IMG/M |
| 3300031890|Ga0306925_10420031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1432 | Open in IMG/M |
| 3300031901|Ga0307406_10952873 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 734 | Open in IMG/M |
| 3300031908|Ga0310900_10867690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 734 | Open in IMG/M |
| 3300031912|Ga0306921_11943335 | Not Available | 628 | Open in IMG/M |
| 3300031912|Ga0306921_12054646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300031943|Ga0310885_10333907 | Not Available | 792 | Open in IMG/M |
| 3300031943|Ga0310885_10683615 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 575 | Open in IMG/M |
| 3300031946|Ga0310910_10227188 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300031946|Ga0310910_10703019 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 799 | Open in IMG/M |
| 3300031947|Ga0310909_11073112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 655 | Open in IMG/M |
| 3300031947|Ga0310909_11110941 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 642 | Open in IMG/M |
| 3300032002|Ga0307416_100241537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1750 | Open in IMG/M |
| 3300032002|Ga0307416_101840542 | Not Available | 709 | Open in IMG/M |
| 3300032004|Ga0307414_10359591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1252 | Open in IMG/M |
| 3300032004|Ga0307414_12058353 | Not Available | 533 | Open in IMG/M |
| 3300032063|Ga0318504_10634655 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 514 | Open in IMG/M |
| 3300032076|Ga0306924_10337520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1728 | Open in IMG/M |
| 3300032126|Ga0307415_100616916 | Not Available | 968 | Open in IMG/M |
| 3300032126|Ga0307415_101909457 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 577 | Open in IMG/M |
| 3300032126|Ga0307415_102130817 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300032180|Ga0307471_103688746 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 542 | Open in IMG/M |
| 3300032180|Ga0307471_103697001 | Not Available | 541 | Open in IMG/M |
| 3300032180|Ga0307471_103909048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
| 3300032205|Ga0307472_101529524 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300032261|Ga0306920_100085611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4645 | Open in IMG/M |
| 3300032261|Ga0306920_102654570 | Not Available | 685 | Open in IMG/M |
| 3300033407|Ga0214472_10011566 | All Organisms → cellular organisms → Bacteria | 9169 | Open in IMG/M |
| 3300034677|Ga0314802_044072 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 515 | Open in IMG/M |
| 3300034681|Ga0370546_080636 | Not Available | 544 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.62% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.01% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.41% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.41% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.01% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.01% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.60% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.60% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.40% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.40% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.40% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.20% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.20% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.20% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.20% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.20% |
| Human Skin | Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin | 0.20% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.20% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.20% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.20% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.20% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.20% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013215 | Human skin bacterial and viral communities - University of Pennsylvania - MG100470 | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026708 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN628 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030574 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031054 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300034677 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1004101022 | 3300000364 | Soil | MGTAATPTRANRTLTGDLRDEATDWCLLADGQALRE |
| F14TC_1051709261 | 3300000559 | Soil | MGQGTKQTRENRTITVDFQNEATYFQLLDNGKAFLEC |
| JGI1027J12803_1075661842 | 3300000955 | Soil | MRTTARQTRDNRTITVDFQNEATYVQLLNDGKAFLECVLAFVMAL |
| JGI1027J12803_1083699103 | 3300000955 | Soil | MRNAAHQTRVNRTITIDFHNEATYCQLLGDGKAFVECVLAFLLALGLQLAHKAT |
| JGI1027J12803_1088737661 | 3300000955 | Soil | MGKATKRTRENRTIPIDFRDEAPYFHLLGAGKAFLECVLAFLLSL |
| JGI10216J12902_1009713892 | 3300000956 | Soil | MGTAAKPTRENRTIIVDFQNETAYVQLLGDGKAFLELVMAFILSLGFQLK |
| JGI25407J50210_101311222 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MGTTAQPTRANRTITVGFRDEATYFHLMEDGKAFLERVLARSNYRTL* |
| Ga0066398_101503311 | 3300004268 | Tropical Forest Soil | VKNTAKRTRENRTITVDFRDEATYFHLLGDGKAFLECVLAF |
| Ga0066397_100087991 | 3300004281 | Tropical Forest Soil | MRNTARRTRENRTITVDFRSEATYVQLLDDGKAFLECILAFVM |
| Ga0063356_1021198951 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MGTAAKPTRATRTITVDFRDEAPYFRLMADGKAFVECVLAFL |
| Ga0066395_108313131 | 3300004633 | Tropical Forest Soil | MSNTARQTRENRTITIDFQNEATYVQLLGDGKAFVECVIAFILSLGFQLKHKAMC |
| Ga0066675_103538731 | 3300005187 | Soil | MHHTTKQPRVNRTITINFQNEVTYVQLLGDRKAFLACVLAFILSIGFQ |
| Ga0065704_105356122 | 3300005289 | Switchgrass Rhizosphere | LGTAGTQTRHNRTITIDFQDEATYIRLLHDGKAFVEFVLAFVRAL |
| Ga0065705_105658942 | 3300005294 | Switchgrass Rhizosphere | MRTTTRQPRKNRTITVDFRDKATYVQLHGDGKALLAVSSPA* |
| Ga0065705_106864031 | 3300005294 | Switchgrass Rhizosphere | MRNTARQTCDNRTITVDFRSEASYFQLLGDGKAFLECILA |
| Ga0065707_109576571 | 3300005295 | Switchgrass Rhizosphere | MRNSAHQTRANRTITIDFHNEATYFRLLNDGKAFVECVLAFVLALGFQLTHT |
| Ga0066388_1019511941 | 3300005332 | Tropical Forest Soil | MGNATKATRENRTITVDFHNEATSMQLLGDGKAFVECVLA |
| Ga0066388_1033402781 | 3300005332 | Tropical Forest Soil | MGKAAKQTRENRTVTVDFRDEATYFQLLGDGKAFLECILAFLLALGFQLKHKAICDGG |
| Ga0066388_1046112272 | 3300005332 | Tropical Forest Soil | MRSRAKQPRENRTITVDFQNEATYFQLLGDGKAFLEFVFALGVFERRGRTWG* |
| Ga0066388_1075741242 | 3300005332 | Tropical Forest Soil | MRNTARQTRENRTITVNFQSEAAYFQLLGDRKAFLECVLAFVLSLGFQ |
| Ga0066388_1080833041 | 3300005332 | Tropical Forest Soil | MPKQARQTRENRTITIDFQNEATYFQLLGDGKAFLECVFAFLLSLGFQLKPTFKESG* |
| Ga0066388_1088203631 | 3300005332 | Tropical Forest Soil | MGQAAKRTRENRTITVDFRDDATYLQLLGNGKAFVEFVGAF |
| Ga0070705_1013167832 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNTARQIRENRTITVDFHDEATYFRLIDDRKAFVECVLAFLLALGFQHWPPTVA* |
| Ga0070700_1019199432 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHTARQTRENRTITVNFQSEASYFQLLSDRKLFLECVLAFVLSLGFQLKHKAT |
| Ga0070708_1011069761 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHTARQTRENRTITVDFQNEATYYQLLGDGKAFVECVLAFL |
| Ga0066689_101744922 | 3300005447 | Soil | MRTTACQPRENRTITVDFQDETTYFQLLLSDGKAFVECVLAFLLSLGFQ |
| Ga0070706_1007318052 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTTARQTRENRTITVDFHNEATYFQLLGDGKAFVECVLAFILSLGFQ* |
| Ga0070707_1002283544 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNPARQTRENRTITIDFQHEATYFQLLGDGKAFLECILAFVLSLGFQLKHKATCGGGGC |
| Ga0070707_1006789462 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQTAKVTRKNRTITVDFYNEATYDQLLDDTKAFVECVLA |
| Ga0070698_1013479751 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTAAKPTRVNRTITVDFQNETTYVQLLGDGRAFVECVLAF |
| Ga0070697_1002382693 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNTARQTRENRTLTIDFQNEATYFQLLGDGKAFLECVLAFVLSLGFQLKHKA |
| Ga0066697_105226351 | 3300005540 | Soil | MGQAAKPTRHNRTITVDFQDEATYFQLLGDTQAFVEFV |
| Ga0066701_102766311 | 3300005552 | Soil | MRNTTRQTRENRTITVDFHNEATDYQLRGDGKAFVECVL |
| Ga0066695_102126701 | 3300005553 | Soil | MQNTARQTRENRTITVDFQNEATYFQLLGDGKAFVELVVAFIL |
| Ga0066704_103145022 | 3300005557 | Soil | MRNTTRQTRENRTITVDFHNEATDYQLRGDGKAFVECVLAFLLA |
| Ga0066670_106104721 | 3300005560 | Soil | MGKASKQTRTNRTITIDFRDDATYYQLLGDGKAFVECVLAF |
| Ga0068857_1001130773 | 3300005577 | Corn Rhizosphere | MGTAAKPTRGNRTITVDFRDEATYFHLLSDGKAFLECVFAFLLST* |
| Ga0066905_1004315421 | 3300005713 | Tropical Forest Soil | MGIAAQPTRENRTITVDFRSEATYFRLLGDGKAFLECVLAFVM |
| Ga0066905_1017652751 | 3300005713 | Tropical Forest Soil | LGTATTPTRHNRTITVDSHDESTYYHLLDDGKAFLECVLAFLLSL |
| Ga0068861_1022810692 | 3300005719 | Switchgrass Rhizosphere | MGTAVKPIRENRTITVDFRSEATYFQLLGDGKAFLECV |
| Ga0066903_1017852842 | 3300005764 | Tropical Forest Soil | MPNTAHQTRENRTITIDFQNEATYFQLLGDGKAFVECV |
| Ga0066903_1029168992 | 3300005764 | Tropical Forest Soil | MGTAATPTRENRTITVDFRDEATYFRLLGDGKAFLDRRDTMLVH* |
| Ga0066903_1049800611 | 3300005764 | Tropical Forest Soil | MSTAAKQTRKNRTITVDFRDEATYVQLLGDGKAFVECVC |
| Ga0066903_1063592832 | 3300005764 | Tropical Forest Soil | MPNTARQTRENRTITIDFQNEATYFQLLGDGKAFVEFVIAFILSLGFQLKHKA |
| Ga0066903_1074821412 | 3300005764 | Tropical Forest Soil | MGQAAKRTRANRTITVDFRDDATYLQLLGNGKAFVEFV |
| Ga0066903_1076266001 | 3300005764 | Tropical Forest Soil | MRTTARQTRENRTITIDFQNEVTYFQLLGNGKAFVECVLAFLLALGLQLKRIFPPNPKH* |
| Ga0066903_1077988062 | 3300005764 | Tropical Forest Soil | MSTAAKQTRTNRTITVDFRDDATYAQLLGDGKAFVDTTW* |
| Ga0066903_1078475881 | 3300005764 | Tropical Forest Soil | MRNTARQTRENRTITVNFQSEASYFQLLSDRKAFLECVL |
| Ga0081455_102072763 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGKAFTRTGANRTITIDFQNEATYFQLLGDGKAFLECVLAFLLALGFQLTHKAT* |
| Ga0081455_109394931 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRHTARQTRANRTITVDFQNEATYFQLLSDGKAFVEF |
| Ga0081538_100701811 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MGQAAKRTRDNRTITVDFRDEATYFQLLGDGKAFLECVLAFVLSLGF |
| Ga0081538_100704182 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MDTAAQPTRENRTITVDSRDEATYFGLIKDGKAFVEFVLAFLLSLGF* |
| Ga0081540_10251711 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MSTAAKQTRENRTITVDFRDEATYVQLLGDGKAFVG* |
| Ga0081539_100397885 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MGTAAKQTRENRTITVDFRDESTYCELLGDGKAFVECVFAVLLTLGFQLLLKTT |
| Ga0066696_101839771 | 3300006032 | Soil | MGQAGKRTRHNRTITVDFQNEATYFQLLGDGKAFVECVMAFLHG* |
| Ga0075417_104771831 | 3300006049 | Populus Rhizosphere | HMGTAAKATRENRTITVDFQNEATYLQLLDPTSALC* |
| Ga0075427_100204512 | 3300006194 | Populus Rhizosphere | MRNSTHQTRTNRTITIDFHNEATYGQLLGDGKAFVECVLAFVLALGFQ* |
| Ga0066658_100404213 | 3300006794 | Soil | ACQPRENRTIAVDFQDETTYFQLLLNDGKAFVECVL* |
| Ga0066658_109077001 | 3300006794 | Soil | MGNATKTTRINRTITVDFQNDATYCQLLDDGKAFLECVLAFVMSFGWFCRKFSSEVI |
| Ga0066659_102069791 | 3300006797 | Soil | MRTSARQTRENRTITVDFQHEATYFQLLGDGKAFVELVIAFVMPLASEA* |
| Ga0066659_106676881 | 3300006797 | Soil | MGKAAKQTRENRTVTVDFRDEATYFQLLGDGKAFLECVLAFL |
| Ga0066659_112151921 | 3300006797 | Soil | MRTTARQTRDNRTITVDFQNEATYFRLLGDGKAFVECV |
| Ga0079220_119455553 | 3300006806 | Agricultural Soil | MRITARQTCENRTITVDFQNEATYFQLLGDGKAFVECVLAFLLVESKNSC |
| Ga0075428_1000845016 | 3300006844 | Populus Rhizosphere | MRTTARQTRENRTITVDFRSEAIYFQLLGDRKAFL |
| Ga0075428_1002005671 | 3300006844 | Populus Rhizosphere | MQKQAHQTRENRTITVHFQNEATYFHLLGNGKAFLECVLA |
| Ga0075428_1021175671 | 3300006844 | Populus Rhizosphere | MLNTTRPTRKNRTITVDFQNEATYFQLLDDSKAFVECVLAFLLALG |
| Ga0075421_1002725053 | 3300006845 | Populus Rhizosphere | MHNTARQTRENRTITVDFQNEATYFQLLGDSKAFGNCSGIPGG* |
| Ga0075421_1018422401 | 3300006845 | Populus Rhizosphere | MRTAARQTRANRTITVDFQNEATYLQLLGNGKAFLECVLAFVLS |
| Ga0075421_1018945482 | 3300006845 | Populus Rhizosphere | MSTAAKRTRENRTITVDFQNEATYLQLLGDGKAFVEF |
| Ga0075430_1002728084 | 3300006846 | Populus Rhizosphere | MGQAAKRTHENRTITVDFRDEATYCQLLGNGKAFVECVLAFVL |
| Ga0075430_1012212802 | 3300006846 | Populus Rhizosphere | MGDTAKATRANRTITVNFQDESTYLQLLSDGKAFVEF |
| Ga0075430_1015607612 | 3300006846 | Populus Rhizosphere | MGQAAKQTRENRTITVDFQDETTYFQLLSDGKAFVELVLAFIL |
| Ga0075431_1002159581 | 3300006847 | Populus Rhizosphere | MSTAAKRTRENRTITVDFQNEATYLQLLGDGKAFLEC |
| Ga0075431_1003350001 | 3300006847 | Populus Rhizosphere | MRNTARQTRENRTLTIDFRNEATSLQLLGDGKAFLECVLAFVLSLGFQLKHKATC |
| Ga0075433_104489573 | 3300006852 | Populus Rhizosphere | MGQAAKRTHENRTITVDFRDEATYFHLLGNGKAFVE |
| Ga0075420_1000584098 | 3300006853 | Populus Rhizosphere | MGNTAKATRENRTMTVDFQEDSAYLQLLSDGKAFVEF |
| Ga0075420_1001373122 | 3300006853 | Populus Rhizosphere | MRHPTRRTRENRTITVDFRSEATYFQLLGDGKAFLACVLA |
| Ga0075420_1001753212 | 3300006853 | Populus Rhizosphere | MQKQAHQTRENRTITVHFQNEATYFHLLGNGKAFLECVLAF |
| Ga0075420_1002706251 | 3300006853 | Populus Rhizosphere | MHHTARQTRENRTITVDFQNEATYYQLLGDGKAFLECVLAFLFALGFQ |
| Ga0075420_1010966693 | 3300006853 | Populus Rhizosphere | MGTAAKPTRVNRTITVDFQDETTYVQLLGDGRAFVEWKMSHRC* |
| Ga0075420_1014761552 | 3300006853 | Populus Rhizosphere | MRSQAKQPRENRTITVDFRNEATYFQLLGDGKAFLECV |
| Ga0075425_1018969672 | 3300006854 | Populus Rhizosphere | MRNTARQTRENRTLTIDVQNEATSFQLLGDGKAVLECILAFVMSLGFQL |
| Ga0075434_1007691652 | 3300006871 | Populus Rhizosphere | MGKAAKQTRENRTVTVDFRDEATYFQLLGDGKAFLECVLAFLLALGFQLKHKA |
| Ga0075429_1000917694 | 3300006880 | Populus Rhizosphere | MRNTARQTRENRTITIDFQNEATYFQLLGDGKAFLECVLA |
| Ga0075429_1019992802 | 3300006880 | Populus Rhizosphere | MRNTARQTRENRTITVDFHDEATYFRLIDDGKAFVECVLAFLLALNAFNKRLRYS* |
| Ga0068865_1020228271 | 3300006881 | Miscanthus Rhizosphere | MQNTTRQTRENRTITVDFQNEATYFQLLGDGKAFLECVIAFVMS |
| Ga0075424_1005222543 | 3300006904 | Populus Rhizosphere | MGHAAKPIRHNRTITVDFRDETTYFALLGDTKAFVECVL |
| Ga0075424_1015012081 | 3300006904 | Populus Rhizosphere | MPKQARQTRENRTITIDFQNEATYFQLLGDRKAFLECVLAFLLSLGFQL |
| Ga0079216_106980682 | 3300006918 | Agricultural Soil | MCTAAKPTREDRTITVDFRDEATYFRLIEDGQAFVE* |
| Ga0075419_100253611 | 3300006969 | Populus Rhizosphere | MRSRARQTRENRTITVDFQNEATYVQLLGDGKAFLECVMAF |
| Ga0075419_101815784 | 3300006969 | Populus Rhizosphere | MGTAAKLTRENRTITIDFQDEAPYFRLLDNGKAFVEC |
| Ga0075419_105294642 | 3300006969 | Populus Rhizosphere | MSTAAKPTRANRTITVDFRDEATYFHLIENGKAFVECVLAFLLVLGFQ |
| Ga0075419_110607022 | 3300006969 | Populus Rhizosphere | MRNTTKQPRANRTITIDFQNEATYFQLLGDGKAFVECVLAFLLALGFQLLHKATCR |
| Ga0075419_113016641 | 3300006969 | Populus Rhizosphere | MGQAAKRTRENRTITVDFRDEVTYFQLLGNGKAFVE |
| Ga0079218_117443191 | 3300007004 | Agricultural Soil | MRHTTRQTRENRTTTVDFHNEAAYSQLLGNGKAFVECVLAFLLAL |
| Ga0099791_104655351 | 3300007255 | Vadose Zone Soil | MGKASKQTRANRTITIDFQHEATYFQLLGDGKAFLELV |
| Ga0099793_102512661 | 3300007258 | Vadose Zone Soil | MRNTARQTRENRTLTIDFQNEATYFQLLGDGKAFLECILAFVLSLGFQLKHKAT |
| Ga0066710_1008213131 | 3300009012 | Grasslands Soil | MRTTACQPRANRTITVDFQDETTYFQLLLSDGKAFVKCVLAFLLSLGFQMKFPATCR |
| Ga0066710_1013169642 | 3300009012 | Grasslands Soil | MRTTARQTRDHWTITVDFHNKAPSVQLLGAGKAISGGVR |
| Ga0066710_1035907391 | 3300009012 | Grasslands Soil | MGTAAQPTRANRTITVDFRSEATYFQLLGDGKAFLECVNAFVMSLGFQLK |
| Ga0099829_100585542 | 3300009038 | Vadose Zone Soil | MEKAATPTRANRTITVDFHNEATYFQLLGDGKAFVECVLAFLLALGFQL* |
| Ga0099829_101608852 | 3300009038 | Vadose Zone Soil | MRNTARQTRENRTITVDFQHEATYCQLLSDGKAFVEWDRLRVSVF* |
| Ga0099829_102879422 | 3300009038 | Vadose Zone Soil | MGTAAKPTRENRTITVDFQNEATYFQRLGDGKAFLGFV* |
| Ga0099829_106630041 | 3300009038 | Vadose Zone Soil | MRNTTKQPRANRTITIDFQNEATYFQLLGDRKAFLECVLAFILSIGVKNNHR* |
| Ga0099829_108638351 | 3300009038 | Vadose Zone Soil | MGDAATATRENRTITVDFQDESTYLPLLSDGKAFVEFVVAFLL |
| Ga0105098_100606712 | 3300009081 | Freshwater Sediment | MGTAAKLTRENRTITVDFHNGTTYFQLLGDGKAFV |
| Ga0105103_108150721 | 3300009085 | Freshwater Sediment | MAKQKRENRTITIDFNDEATYHQLCQDGRAFIEVVVAFIMSLGFQLKHHCSCPGGFA* |
| Ga0099830_105009991 | 3300009088 | Vadose Zone Soil | MGTAAKLTRENRTITVDFRDDATYFRLLEDGKAFVECVL |
| Ga0099830_105113662 | 3300009088 | Vadose Zone Soil | MRNTARQTRENRPLTIDFQNEATYFQLLGDGKAFRHPSAP |
| Ga0099828_100349474 | 3300009089 | Vadose Zone Soil | MEKAATPTRANRTITVDFHNEATYFQLLGDGKAFVECILAFLLALGFQL* |
| Ga0099828_108451851 | 3300009089 | Vadose Zone Soil | MRTTAHQARENRTITVDFQNEATYFQLLGDGKAFLECVLAFL |
| Ga0099828_118832201 | 3300009089 | Vadose Zone Soil | MGTASKQTRTNRTITIDFQNEATYFQLLGDGKAFLECVLAFV |
| Ga0099828_119645241 | 3300009089 | Vadose Zone Soil | MGTAAKPTRDNRTITVDFRDEAAYFHLLGDGKAFLEC |
| Ga0099828_119915151 | 3300009089 | Vadose Zone Soil | MQSQAQHARENRTIPVDFQDETPYCRLLGDGKAFLEFALAFLLSLGFQLTHQATC |
| Ga0099827_102199831 | 3300009090 | Vadose Zone Soil | MGTAAKRTRENRTITVDFQNEATYFQLLGDGKAFVE |
| Ga0099827_104769473 | 3300009090 | Vadose Zone Soil | MEKAATPTRANRTITVDFQNAATYVHLLGDGKAFVECVLAFLLTLGFQ |
| Ga0099827_112993991 | 3300009090 | Vadose Zone Soil | MGQAAKQSRENRTITVNFEDETTYFQLLDNGKAFVELVLAFIL |
| Ga0099827_116805871 | 3300009090 | Vadose Zone Soil | AAKATRENRTITVDFQDEITYVHLLEDGKAFLECVLAFR* |
| Ga0099827_117238302 | 3300009090 | Vadose Zone Soil | MRNTARQTRENRTITVDFQNEATYFQLLGDGKAFLECVLAFLFALGFPL* |
| Ga0099827_117362821 | 3300009090 | Vadose Zone Soil | MRSQANHPRENRTSTVDFQHATTSFQLRGDGKACLELVMAFLMSLGFPLKHK |
| Ga0099827_119203432 | 3300009090 | Vadose Zone Soil | MRNTTHQTRENRPITVDFHNEAPYTQLLGNGKAFIECVVAFLLSIGF |
| Ga0111539_124614651 | 3300009094 | Populus Rhizosphere | MGPATKPTRENRTITVDCRDDVTYFRLLKDGKAFVECVLAFLLALGFQLK |
| Ga0075418_107883791 | 3300009100 | Populus Rhizosphere | MGTAAKQIRANRTITVDFRDDATYLQLLGDGKAFVEFV |
| Ga0075418_114260381 | 3300009100 | Populus Rhizosphere | MRSTARQTHANRTITVDFQNEATYFQLLGDGKAFVELVLAFV |
| Ga0075418_115704411 | 3300009100 | Populus Rhizosphere | MHNTAHQTRENRTITVDFQNEATYFQLLGDGKAFVECVIAFIGSSAWK* |
| Ga0075418_116180862 | 3300009100 | Populus Rhizosphere | MHNTARQTRENRTITVDFQHEATYFQLLGDGKAFVE |
| Ga0075418_118161671 | 3300009100 | Populus Rhizosphere | MRNPTRQTRENRTITVDFQNEATYFQLLGDGKAFVECVMAF |
| Ga0075418_126536471 | 3300009100 | Populus Rhizosphere | MGTAAKRTRENRTITVDFRDDATYLQLLGDGKAFVEFV |
| Ga0066709_1003379051 | 3300009137 | Grasslands Soil | MRTSARQTRENRTITVDFQHEATYFQLLGDGKAFVELVIAFVMSLGFG |
| Ga0066709_1007568781 | 3300009137 | Grasslands Soil | MGTAAKPTRENHTITVDFQDETTYYQLLGDGKAFLELVMAFIGCVPLGCG* |
| Ga0066709_1010367041 | 3300009137 | Grasslands Soil | LGTAATRARHNRTITVDFQDETTYFRLLDDGKAFLECILA |
| Ga0066709_1041056211 | 3300009137 | Grasslands Soil | MGTAAKPTRENRTITVDFRDEATYFRLLEDGKAFLE |
| Ga0066709_1044937981 | 3300009137 | Grasslands Soil | MSTAAKRIRANRTITGDFHAEATCFQLLGDGKAFVACVLAF |
| Ga0066709_1046554771 | 3300009137 | Grasslands Soil | MRIAATPTRANRTITVDFENEATYFHLLGDGKAFV |
| Ga0099792_102119421 | 3300009143 | Vadose Zone Soil | MRNTARQTRENRTLTIDFQNEATYFQLLGDGKAFLECVLAF |
| Ga0099792_107473321 | 3300009143 | Vadose Zone Soil | MGQTAKTVRENRTITVDFQDRSTYFQLMHEGKACVECV |
| Ga0114129_125471531 | 3300009147 | Populus Rhizosphere | MAKTANRIRENRTITVDFQDESTYFQLLDDGKAFVEFVLAFIL |
| Ga0114129_128487952 | 3300009147 | Populus Rhizosphere | MRSQAKQPRANRTITVDFQNEATYFQLLGDGKAFLEFVFAFLLS |
| Ga0114129_130008371 | 3300009147 | Populus Rhizosphere | MDTAAKPKRENRTIIVDFQNETTYVQLLGDGKAFLELVMAFILSLG |
| Ga0105243_125610101 | 3300009148 | Miscanthus Rhizosphere | MCTATKPTRENRTITVDFRDEATYFHLIADGKAFVECVLAF |
| Ga0111538_100313961 | 3300009156 | Populus Rhizosphere | MRPTARQTRENRTITVDFRSETTYFQRLGDGKAFLECVLA |
| Ga0111538_104499423 | 3300009156 | Populus Rhizosphere | MRNTSSLTHENRTITVDFRSEATYFQLLGEGKAFLACVLACVLSLGLQLKHK |
| Ga0111538_112785212 | 3300009156 | Populus Rhizosphere | MGPATKPTRENRTITVDCRDDVTYFRLLKDGKAFVECVLAFLLALGFQLKHKATC |
| Ga0111538_121945711 | 3300009156 | Populus Rhizosphere | MSIVAKPTRANRTITVDFRDNATYFCLLADGKAFAWGS* |
| Ga0111538_122538491 | 3300009156 | Populus Rhizosphere | MEQAAKSTRQNRTITIDFQDETTYLQLLGDPQAFVEF |
| Ga0075423_110179812 | 3300009162 | Populus Rhizosphere | MRNIDRRTRENRTMTVDFRNEATYLQLLGDGKAFLACILAFVMSLGFQLQH |
| Ga0075423_123841711 | 3300009162 | Populus Rhizosphere | MGKATKRTRENRTITIDFRDEATYFHLLDDGKAFLECVLAFMLS |
| Ga0075423_125010072 | 3300009162 | Populus Rhizosphere | MGQAAKRTRENRTLTVDFQDETPYFQLFSDGKAFVALVLAYLLSLGF |
| Ga0105104_100523181 | 3300009168 | Freshwater Sediment | MGTAAKPIRENRTITVDFQSEATYFQLLGDGKAFLECVIAFVLSLGF* |
| Ga0105104_102301042 | 3300009168 | Freshwater Sediment | MRNAAHQSRENCTITVDFQNETTYVQRLGDGKAFVELVLAFILLLGFQLHTRRAVAAAEA |
| Ga0105104_102484553 | 3300009168 | Freshwater Sediment | MGKASKPIRANRTITVDFQNEATYFQLLGDGKAFVECVLAFVLSLG |
| Ga0105242_105404021 | 3300009176 | Miscanthus Rhizosphere | MGQAAKPTRQNRTITVDFQDEATYFQLLGNTRAFVE |
| Ga0105242_130539981 | 3300009176 | Miscanthus Rhizosphere | MGTAAKPTRENRTITVDFQNATTYVQLLGDSKAFVELVLAFIL |
| Ga0114945_108863271 | 3300009444 | Thermal Springs | MGTAATPTRVNRTSTVDFQDETTYVQLLGDGRACVACVLAFLLALC |
| Ga0105249_106235522 | 3300009553 | Switchgrass Rhizosphere | MRSKPRQTRENRTITVDFQNEATYVQLLGDGKAFVELVRFPWI* |
| Ga0105249_106466781 | 3300009553 | Switchgrass Rhizosphere | MRYTIRQTCENRTITVDFHNEATYYQLLGDGKAFIECVLAFL |
| Ga0105249_110561071 | 3300009553 | Switchgrass Rhizosphere | MSTAAKQTRENRTITVDFRDEATYVQLLGDGKAFVECVYA |
| Ga0105340_15394442 | 3300009610 | Soil | MGQTVKATRENRTITVDFQDQTTYFRLLDDTKALVVYLYRAANSAA* |
| Ga0126374_109504102 | 3300009792 | Tropical Forest Soil | MRQAAKRTRENRTITVDFRDDATYLQLLGNGKVVMSM* |
| Ga0126374_116515351 | 3300009792 | Tropical Forest Soil | MRTTARQTRANRTITVDFQNEATSFRLLGDGKAFVECVLAFLLSLGF |
| Ga0105081_10728261 | 3300009806 | Groundwater Sand | MGTAAKPTREDRTITVDFRDEATYFRLIEDGQAFVE* |
| Ga0105061_10056873 | 3300009807 | Groundwater Sand | MGTAAKPTRENRTITVDFRDDAAYFHLIADGKAFVECVLAFLLA |
| Ga0105061_10390921 | 3300009807 | Groundwater Sand | MGHAAKRTRENRTITVDFQDETTYFQLLGDNNGKAFVELVLAFILSLGFQLKHKAT |
| Ga0105057_10116311 | 3300009813 | Groundwater Sand | MCTAAKPTQEDRTITVDFRDEATYFRLIEDGQAFVE* |
| Ga0105062_10850191 | 3300009817 | Groundwater Sand | MRNTARQTRDNRTITVDFRSEATYFQLLGDGKAFLECVLAFVMAL |
| Ga0105062_10885651 | 3300009817 | Groundwater Sand | MGTAAKPTRENRTITIDFQHETTYFQLLGDGTAFLELVTAFILSLGFQLKHKATCR |
| Ga0105085_10084191 | 3300009820 | Groundwater Sand | MRENRTIIVDCQHETTDVQLLGDGKAFLALVMAFILSLGFQLKHKATWRG |
| Ga0105085_11226961 | 3300009820 | Groundwater Sand | MGKASKQTRENRTITIDFQNEATYFQLLGDGKAFL |
| Ga0105066_10280822 | 3300009822 | Groundwater Sand | MRTAAKPTREDRTITVDFRDEATYFRLIEDGQAFVE* |
| Ga0105066_11566852 | 3300009822 | Groundwater Sand | MGTAAQATRDNWTITVDFHNEATYYQLLGKAFLECVLAFLLSLGFQLKHRATCGGG |
| Ga0126313_110449872 | 3300009840 | Serpentine Soil | MGTAAKPTRENRTITVDFQNETTYFQLLGDGKAFLECVLAFW* |
| Ga0126313_114623272 | 3300009840 | Serpentine Soil | MDKAAKQTRTNRTITIDFQHEATYHQLLGDGKALVELVMAFILSLGFQL |
| Ga0126315_103784623 | 3300010038 | Serpentine Soil | MGTAAKPTRENRTITVDFQNETTYFQLLGDGKAFLECVLAFR* |
| Ga0126380_106999822 | 3300010043 | Tropical Forest Soil | MRNTARQTRENRTLTVDFQNETAYFQLLGDGKAFVECVVASLVALGFQL |
| Ga0126380_107669851 | 3300010043 | Tropical Forest Soil | LGTATTPTRHNRTITVDFHDETTYVQLLGDGKAFVELVMA |
| Ga0126380_110073992 | 3300010043 | Tropical Forest Soil | MRNTARQTRENRTITIDFQNEATYMQLLGDGKAFLECVLAFVMSLGFQLKHKATCGGGG |
| Ga0126380_115460502 | 3300010043 | Tropical Forest Soil | MGTATKRIRNNRTITVDFRDEATYFHLLGDGKAFVEFVCAFLLSL |
| Ga0126380_116816912 | 3300010043 | Tropical Forest Soil | MRNTARQTRVNHTITVDFHDETTYVKLLDDRRAFVEFVLAFLLALGLVLSSY* |
| Ga0126380_120308151 | 3300010043 | Tropical Forest Soil | MRNTTRQTRENRTITVDFHNEATYVQLLGDGKAFVEC |
| Ga0126384_102855721 | 3300010046 | Tropical Forest Soil | MRNKTRQTRENRTITVDFQNEATYFQLLDDGKAFLEFV |
| Ga0126384_103196004 | 3300010046 | Tropical Forest Soil | MRNTTRQTRENRTITVDFRSEATYFQLLGDGKAFLDAHR* |
| Ga0126384_108078851 | 3300010046 | Tropical Forest Soil | MGTAAKPTRENRTITVDFQNETTYVQLLGDGKAFVECV |
| Ga0126384_111603851 | 3300010046 | Tropical Forest Soil | MRNPARQTRDNRTITVDFRSEATYFQLPGDGKAFLECVLAFIIALGFQQ* |
| Ga0126384_111682481 | 3300010046 | Tropical Forest Soil | MRQQARPTRENRTITVDFQHEATYFQLLDDGKAFLEFV |
| Ga0126384_113944261 | 3300010046 | Tropical Forest Soil | MRTTARQTRKNRTITVDFHNEATYFQLLGDGKAFVEFV |
| Ga0126384_114313571 | 3300010046 | Tropical Forest Soil | MRSRAKHPRENRTITVDFQHEATYFQLLDDGKAFIEFVL |
| Ga0126384_114931391 | 3300010046 | Tropical Forest Soil | MPNTARQTRENRTITVDFHNEATYFQLLGDGKAFLECVLAFLLALG |
| Ga0126384_118599901 | 3300010046 | Tropical Forest Soil | MGTAAKPTRDNRTITLDFRDEATYFHLLSDGQAFVEFVFG |
| Ga0126384_119828821 | 3300010046 | Tropical Forest Soil | MRHTTKQLRANRTITIDFQNEATYFQLLGDRKAFLECVLAFILSIGFQLTHK |
| Ga0126384_123227081 | 3300010046 | Tropical Forest Soil | MRNTAHQTRENRTITVDFRSEATYFQLLGDGKAFLECILA |
| Ga0126382_101115702 | 3300010047 | Tropical Forest Soil | MRNTARQTRENRTLTVDFQNETTYFQLLGDGKAKVLQIC* |
| Ga0126382_103024811 | 3300010047 | Tropical Forest Soil | MRTTARQTRENRTITVDFQNEATYGQLLGDGKAFIECVL |
| Ga0126382_108817271 | 3300010047 | Tropical Forest Soil | MRSTARQTRANRTITVDFQNEATYFQLLGDGKAFVELVLAFV |
| Ga0126382_111288841 | 3300010047 | Tropical Forest Soil | MRHTPKQPRANRTITIDFQNEATYFQLLGDRKAFLE |
| Ga0126382_111883932 | 3300010047 | Tropical Forest Soil | MRHTARQTRENRTIPVDFHDEATYCRLIDDGKAFVACVLAFLLALGF |
| Ga0126382_114175012 | 3300010047 | Tropical Forest Soil | MDNAAKAIRENRTITVDFQDQSTYFQLISDGKAFVEF |
| Ga0126382_119346381 | 3300010047 | Tropical Forest Soil | MRNTTRQTRENRTITVDFHDEATYFQLLGDGKAFVEWVIAFISA |
| Ga0126382_123479941 | 3300010047 | Tropical Forest Soil | MGTADKPTRENRTITVDFRSEATYFQLLGDRKAFLE |
| Ga0127503_102722801 | 3300010154 | Soil | MGTAAKPTRENRTITGDFRDDATYFHLIADGKAFVECLLAFLLAIGFQLKPQ |
| Ga0126370_100313381 | 3300010358 | Tropical Forest Soil | MGTAAKPTRANRTITVDFRSEATYFQLLGDGKAFLE |
| Ga0126370_115522871 | 3300010358 | Tropical Forest Soil | MGTAAKPRRENRAITVDFRDKATYFHLMADGKALVECVLAFVLAIGLQ |
| Ga0126370_117539371 | 3300010358 | Tropical Forest Soil | MQNTTRQTRENRTLTVDFQNEATYFQLLGDGKAFLECILAFVMSLGFQFKHKATCNG |
| Ga0126370_124944861 | 3300010358 | Tropical Forest Soil | MSTVAKRTRENRTITVDFRDEATYFQLRGDGKAFVEFVFAF |
| Ga0126376_101829004 | 3300010359 | Tropical Forest Soil | MRNTARQTRENRTITVDFQNEATYFQLLNDGKAFVEFVM |
| Ga0126376_107142091 | 3300010359 | Tropical Forest Soil | MPKQARQTRENRTITIDFQNEATYVQLLGDGKAFLECVFAFLLSLGFQLKHKAT |
| Ga0126372_118060331 | 3300010360 | Tropical Forest Soil | MEQTAKAPRENRTITVDFQDQSTYFQLLHDGKAFVECVYAFR* |
| Ga0126372_119594713 | 3300010360 | Tropical Forest Soil | MTMRTTARQTHENRTITVNFQNETTYVQLLSDGKAFVECVLAFLLALGLQL |
| Ga0126372_128481311 | 3300010360 | Tropical Forest Soil | MRHTPQQPRANRTITVDFQNEATYFQLLGDRKAFLE |
| Ga0126377_102486251 | 3300010362 | Tropical Forest Soil | VGTATKPRRKNRTITVDFQDEATYFQLLGDGKAFVEFVFAFLLA |
| Ga0126377_107472521 | 3300010362 | Tropical Forest Soil | MQNTTRQTRENRTITVDFQNEATYFQLLGDGKAFLECILAFVMSLGFQ |
| Ga0126377_109419211 | 3300010362 | Tropical Forest Soil | MRNTTRQTRENRTITVDFHDEATYFQLLGDGKAFVEWVIAFISALGL |
| Ga0126377_112195881 | 3300010362 | Tropical Forest Soil | MGIVAQPTRENRTITVDFRSEATYFQLLGNGKAFLECVIAFVMSLSL |
| Ga0126377_115981652 | 3300010362 | Tropical Forest Soil | MGRAAQPTRENRTITVDFSSEATYFQRLGDGKAFLECVLALVMSLGFQL |
| Ga0126377_116244691 | 3300010362 | Tropical Forest Soil | MRNTARQTRENRTITVDFRDEATYFQLLGDGKAFVE |
| Ga0126377_118102211 | 3300010362 | Tropical Forest Soil | MQNTPRQTRENRTITVDFQNEAIYFQLLGDGKAFVEFVIAFILS |
| Ga0126377_119603271 | 3300010362 | Tropical Forest Soil | MGTAAKPTRDNRTITVDFRDEATYFHLLNDGKAFVECVFAIC |
| Ga0126377_130105431 | 3300010362 | Tropical Forest Soil | MSTAAKPTRANRTITVDFRDEATYFQLLGNGKAFLECVLAFMLSL |
| Ga0126377_132810371 | 3300010362 | Tropical Forest Soil | MRNTARQTRDNRTITVDFQDEATYFQLLGDGKAFLEFVCA |
| Ga0126379_104529582 | 3300010366 | Tropical Forest Soil | MRTTARQTRKNRTITVDFHNEATYSQLLGDGKAFVECVLA |
| Ga0126379_106647561 | 3300010366 | Tropical Forest Soil | MRNTARQTRENRTLTIDVQNEATYCQLLGDGKAFLECLLAFVMSLGFQ |
| Ga0126379_126165341 | 3300010366 | Tropical Forest Soil | MSTTATPTRENRTITVNFQNEATYVQLLGDGTAFLECILAFVMSLGFQLKPKATCSGEGA |
| Ga0126379_137855502 | 3300010366 | Tropical Forest Soil | MRTTARQTRKNRTITVDFQNEATSVQLLGDGKAFVECVLAFLLALGL* |
| Ga0105239_109777701 | 3300010375 | Corn Rhizosphere | MRNTARQTRENRTITVDFQNEATYVQLLGDGKAFVELVRFPWI* |
| Ga0126383_101878571 | 3300010398 | Tropical Forest Soil | LATAATHRRHNRTITVDFHDETTYFHLLNDGKAFLECVLAFLLSIGF |
| Ga0126383_107347392 | 3300010398 | Tropical Forest Soil | MRNTARRTRENRTITVDFRDEATYFHLLGDGKAFLECVLAIVMSLGFQ |
| Ga0126383_109815861 | 3300010398 | Tropical Forest Soil | MGPAAKRTRENRTLTVDFQNETTYFQLLGDGKAFVECVLAFLLALGFQLAHKATCHGGG |
| Ga0126383_109820731 | 3300010398 | Tropical Forest Soil | MHRTTKQPRVNRTITIDFQNEATYFQLLGDRKAFLECVLAFI |
| Ga0126383_113292462 | 3300010398 | Tropical Forest Soil | MRTTTRQTRDNRTITVDFRDEATYFQLLGDRKAFLE |
| Ga0126383_113409183 | 3300010398 | Tropical Forest Soil | MGTAAKPRRENRTITVDFRDEATYFRLIADGKAFVE |
| Ga0126383_115079672 | 3300010398 | Tropical Forest Soil | MGNATKTTRENRTITVDFHNEATYMQLLGDGKAFVACVLAFLLAL |
| Ga0126383_123179512 | 3300010398 | Tropical Forest Soil | MGNTAQRTRHNRTITVDFQDEATYFRLLDDGKAFVECVLAFLLS |
| Ga0126383_124643741 | 3300010398 | Tropical Forest Soil | MGQTAKPLRENRTLTIDFNDEATYAQLLDDGKAFIE |
| Ga0126383_125943511 | 3300010398 | Tropical Forest Soil | MGTAAKPIRENRTITGDFQSEATYFQLLGNGKAFLECVIAFIMSL |
| Ga0134122_113674382 | 3300010400 | Terrestrial Soil | MRNTTRQTRDNRTITVDFRGEVTYSQLLGDGKAFLECILAFVMALGFQLK |
| Ga0134121_107338272 | 3300010401 | Terrestrial Soil | MRNTARQTRENRTLAVDFHNETTYFQLLGDGKAFVECVLAFLLALGFQHWPPTVA* |
| Ga0137391_105143052 | 3300011270 | Vadose Zone Soil | MPNTARQTRNNRTITVDFYNEATYFQLLGDGKAFV* |
| Ga0137393_112281051 | 3300011271 | Vadose Zone Soil | MRHTARQTRENRTITVDFQNEATYFQLLGDGKAFLGFV* |
| Ga0137462_10447632 | 3300011421 | Soil | MRHTARQTRENRTITGDFQNEATYFQLLGDSKAFVEFVFAFILSLGFQLAHKAS* |
| Ga0137464_12519781 | 3300011434 | Soil | MRHTARQTRENRTITGDFQNEATYFQLLGDSKAFVEFVFAFILSLGFQLAHKASCRDGGC |
| Ga0137389_101670891 | 3300012096 | Vadose Zone Soil | MRNTAPQTRENRTITIDFQDEPTYFPLLGDGKTFVALVIAFILSIGF |
| Ga0137389_103785081 | 3300012096 | Vadose Zone Soil | MRNTARQTRENRTITVDFRDEATYFRLLGDGKAFLECVLAFV |
| Ga0137389_106527023 | 3300012096 | Vadose Zone Soil | MGHAAKRTRENRTITVDFQDETTYLQLLGNGAQLVY* |
| Ga0137388_112887651 | 3300012189 | Vadose Zone Soil | MGKASKQTRTNRTITIDFQNEATYFQLLGDGKAFLEFVCAFLLSLGF |
| Ga0137388_115621081 | 3300012189 | Vadose Zone Soil | MPKQARQTRENRTITIDFQNEATYVQLLGDGKAFLE |
| Ga0137388_115783621 | 3300012189 | Vadose Zone Soil | MQKQARQTRENRTITIDFQNEATYFQLLGDGKAFLECVLAFVLSLGFQLTHKATCG |
| Ga0137383_101633372 | 3300012199 | Vadose Zone Soil | MSTAAKQTRENRTITVDFRDEATYVQLLGDGKAFVECVCAFLLSLAFR* |
| Ga0137383_102089094 | 3300012199 | Vadose Zone Soil | MPKQACQSRENRTITIDSQNETTYVHLLGDGKAFLEFVFAFLLS |
| Ga0137383_104675471 | 3300012199 | Vadose Zone Soil | MRHTARQTRENRTITVDFQNEATYFQLLGDGKAFVEFVFAFI |
| Ga0137383_108949282 | 3300012199 | Vadose Zone Soil | MEQAGKRTRHNRTITVDFQNEATYFQLLGDGKAFVECVMAFLLSL |
| Ga0137383_110770251 | 3300012199 | Vadose Zone Soil | MRNTARQTREHRTITVNFQDEATYFQLLGDGKAFLEFVCAFLLSLGFQL |
| Ga0137382_109996642 | 3300012200 | Vadose Zone Soil | MGTAAKPTRAHRTSTVDVQHETTDVQRLGDGQAFLEWVLAFILSSGLQLTHQATCRGG |
| Ga0137365_104059992 | 3300012201 | Vadose Zone Soil | MGQVAKQSRENRTITVNFEDETTYFQLLDNGKAFVELVLAFVI* |
| Ga0137363_108927202 | 3300012202 | Vadose Zone Soil | MRNATRQTRENPTITVDFHNEATYSQLLGDGKVFLEYVLAFIL |
| Ga0137363_109031992 | 3300012202 | Vadose Zone Soil | MQSQTKQPRENRTITVDFQNEATYFQLLGDGKAFV |
| Ga0137363_115125581 | 3300012202 | Vadose Zone Soil | MRNTARQTRENRTLTIDFQNEATYFQLLGDGKAFLECVLAFVLSLGF |
| Ga0137399_104993162 | 3300012203 | Vadose Zone Soil | MRNTARQTRENRTLTVDFQNETTYFQLLGDGKAFVECVLAFLLALGFQLAHKATSRD |
| Ga0137399_115775181 | 3300012203 | Vadose Zone Soil | MKQTATPTRANRTITVDFQNEATYFQILDDGMAFVECVLAFLLALAFG* |
| Ga0137362_106140551 | 3300012205 | Vadose Zone Soil | MPQQARPPRENRTITVDFHNEATYFQLLGDGKAFVECVLAFLLPLACS* |
| Ga0137362_106603253 | 3300012205 | Vadose Zone Soil | MRNAAKRTRENRTITVDFRDEATYFRLIEGGKAFL |
| Ga0137362_107393821 | 3300012205 | Vadose Zone Soil | MQSQTKQPRENRTITVDFQNEATYFQLLGDGKAFVEL |
| Ga0137362_109620492 | 3300012205 | Vadose Zone Soil | LATAATQTRHNRTITVDVQDETTYVRLRDDGKAFLECVLAFLLTLSFQLTHK |
| Ga0137380_104623732 | 3300012206 | Vadose Zone Soil | MGTAAKATRENRTITVDFQDEITYVHLLEDGKAFLECVLAFR* |
| Ga0137380_106045122 | 3300012206 | Vadose Zone Soil | MRNTDRRTRENRTMTGDCRNEATYFQLLGDGKAFRECLLAFVMSLGFQLQHKATCQGEGC |
| Ga0137381_101127951 | 3300012207 | Vadose Zone Soil | MGTAAKATRDNRTITVDFHNEATYYQLLGDGKAFLECVLAFIL* |
| Ga0137381_111758561 | 3300012207 | Vadose Zone Soil | MRQTAKRTRENRTITVDFQNEATYFQLLGDGKAFV* |
| Ga0137379_107030412 | 3300012209 | Vadose Zone Soil | MSTAAKQTRENRTITVDFRDEATYVHLLGDGKAFVECVCAFLLSLAFR* |
| Ga0137378_100630854 | 3300012210 | Vadose Zone Soil | MGTAAKPTRENRTITVDFQNETTYFQLLGDGKAFVECVLAFLLAL |
| Ga0137378_103268543 | 3300012210 | Vadose Zone Soil | MRNTARQTRENRTITIDFQNEATYFQLLGDGKAFLECVLAFVLALGFQLKHKATCGGGE |
| Ga0137377_109612071 | 3300012211 | Vadose Zone Soil | VTPAKHRPPRENRTITVDFQNGATCLQWLDDGKAFVELVIAFMVLSTY* |
| Ga0137377_119031231 | 3300012211 | Vadose Zone Soil | MEQAGKRTRHNRTITVDFQNEATYFQLLGDGKVFVDC |
| Ga0137387_102811483 | 3300012349 | Vadose Zone Soil | MVTTAKPTRVNRTITVDFRDKATYFHLIANGKALVECVLAFVLAIGFQLK |
| Ga0137387_108458483 | 3300012349 | Vadose Zone Soil | MGQSAKPTRHNRTITVDFQEPSTYLYLMNDGKAFVECV |
| Ga0137387_111400911 | 3300012349 | Vadose Zone Soil | MRQTAKRTRENRTITVDFQNEATYFQLLGDGKAFVEFVLA |
| Ga0137387_113068702 | 3300012349 | Vadose Zone Soil | MRSTAHQTRENRTITVDFQNEATYFQLLGDGKTFVQLVIAFILALGGCPRISRSAS* |
| Ga0137372_110542111 | 3300012350 | Vadose Zone Soil | MRNTDRRTRENRTMTVDFRNEATDFQLLGDGKAFLECLLAFVMSLGLQLQHKATCQGDGC |
| Ga0137366_105931542 | 3300012354 | Vadose Zone Soil | MRNTARQTRENRTITVDFQDETTYDRLLDDGKAFVEFV |
| Ga0137369_103569562 | 3300012355 | Vadose Zone Soil | MTWGRHMSTAAQPTRHNRTITVDFRSEATYFQLLG |
| Ga0137369_106613761 | 3300012355 | Vadose Zone Soil | MRTTNRQTRENRTITVDFRDEATYVQLLGDGKAFLECILAFV |
| Ga0137371_105372111 | 3300012356 | Vadose Zone Soil | MPKQACQSRENRTITIDSQNETTYVQLLGDGKAFLEFV |
| Ga0137371_110615641 | 3300012356 | Vadose Zone Soil | MGTAAKPTRENRTITVDFHDAVTYVQLLGDGKAFVECVLAFLLA |
| Ga0137384_101117401 | 3300012357 | Vadose Zone Soil | MCNTARQTRENRTITVDFQNEATYLQLLGDGKAFVECVLAFILSL |
| Ga0137368_107212962 | 3300012358 | Vadose Zone Soil | MGTAAKPTRANRTITVDFRDEATYFCLIEDGCLIE |
| Ga0137385_103429853 | 3300012359 | Vadose Zone Soil | MGTTAKPTRVNRTITVDFRDKATYFHLIANGKALVECVLAFVLAIG |
| Ga0137385_108301271 | 3300012359 | Vadose Zone Soil | MRNTARQTRENRTITVDFQDETTYFQLLGDGKAFL |
| Ga0137385_110963042 | 3300012359 | Vadose Zone Soil | MGQAAKQSRENRTITVNFEDETAYFQLLDNGKAFVELVLAFVI* |
| Ga0137360_108201202 | 3300012361 | Vadose Zone Soil | MQKQARQTRENRTITIDFQNEATYFQLLADGRTFVE |
| Ga0137360_112879222 | 3300012361 | Vadose Zone Soil | MGTTTKATRENRTITVDFQDGITYVHLLEDGKAFLECVLAFR* |
| Ga0137360_115998931 | 3300012361 | Vadose Zone Soil | MRTTARQTRENRTITVDFQNEAIYFQLLGDGKAFVEFVLAFLL |
| Ga0137361_103449632 | 3300012362 | Vadose Zone Soil | MEQAGKRTRHNRTITVDFQNEATYFQLLGDGKVFVDYSR* |
| Ga0137361_108941221 | 3300012362 | Vadose Zone Soil | MGHAAKRTRENRTITVDFQDETTYFQLLGDGKAFLECVLAFVLS |
| Ga0137361_110436362 | 3300012362 | Vadose Zone Soil | MGQGATRTRENRTITVDVQDETTYFQLLGDGKAFVELVLAFILSLGFQLKHK |
| Ga0137361_110488601 | 3300012362 | Vadose Zone Soil | MGQTAKPPRENRTLTIDFNDEATYAQLLDDGKAFIEFV |
| Ga0137390_109577132 | 3300012363 | Vadose Zone Soil | MRNTPKQPRANRTITIDFQNEATYFQLLGDRKAFLECVLAFILSIGVKNNHR* |
| Ga0137390_115843881 | 3300012363 | Vadose Zone Soil | MCNTTHQTRENRTITVDFQNEATYFQLLGDGKAFVELVL |
| Ga0137390_116288901 | 3300012363 | Vadose Zone Soil | MRNTAHQTRENRTITIDFQNEATYFQLLGDGKAFVECILAFLLALGFQL* |
| Ga0150984_1189054822 | 3300012469 | Avena Fatua Rhizosphere | MGTAAKPMRENRTVIVDFQNETTYVQLLGDGKAFLELVMAFILSLGFQLKHKARFQRIKW |
| Ga0137358_103299113 | 3300012582 | Vadose Zone Soil | MGTAAKPTREHRPITVDFRDEATDFCLIADGKALLAWVI |
| Ga0137358_104646152 | 3300012582 | Vadose Zone Soil | MRTTARQTRENRTITGDFQNEATYFQLLGDGKAFLECILAFLLSL |
| Ga0137358_110716491 | 3300012582 | Vadose Zone Soil | MRNTARQTRDHRTITVDFQHEATYCQLRGDGKALVEFIV |
| Ga0137395_103688741 | 3300012917 | Vadose Zone Soil | TRANRTITVDFHDEATYFHLLGDGKAFVECVLAFLLALGFQRLSGNLVALLQ* |
| Ga0137395_104691752 | 3300012917 | Vadose Zone Soil | MRNTARQTRENRTLTVDLQNETIYFQLLGDGKAFVECVLAFLLALGFQLAHKATS |
| Ga0137395_106090542 | 3300012917 | Vadose Zone Soil | MRQGSKRIRSNRTITIDFQDEATYFRLLDNGKAFVECVLAF |
| Ga0137396_105414762 | 3300012918 | Vadose Zone Soil | MRNTARQTRENRTLTIDFQNEATYFQLLGDGKAFLECVLAFVLSLGFQLKHKATCGGGGC |
| Ga0137396_110024201 | 3300012918 | Vadose Zone Soil | MRNTARQTRENRTITVDFQNEATYFQLLDDSKTFL |
| Ga0137394_100139554 | 3300012922 | Vadose Zone Soil | MCTAAKPTQEDRTITVDFRDEATYFRLIEIGQAFVE* |
| Ga0137394_100716513 | 3300012922 | Vadose Zone Soil | MGKVSKQTRTTRTITIDFQHEATYFQLLGDGKAFLE* |
| Ga0137394_102395694 | 3300012922 | Vadose Zone Soil | MPNPVRQTRDNRTITVDFQSEATYVQLLGNGKAFVECVLAFV |
| Ga0137394_106024952 | 3300012922 | Vadose Zone Soil | MGTAAQPTRENRTITVDFRSEATYFQLLGDGKAFLECVIAFV |
| Ga0137394_107236401 | 3300012922 | Vadose Zone Soil | MGNGTKTTRENRTITVDFHDENNYFQLICDGTAFVEFVL |
| Ga0137394_112262991 | 3300012922 | Vadose Zone Soil | MGTAAKPTRENRTITVDFRDEATYFSLMEDGRAVLECVLASSCP |
| Ga0137394_113172182 | 3300012922 | Vadose Zone Soil | MRNTTCQTRENRTITVDFHNEATSYQLLGDGKAFVECVLAFLLALGFQLTHK |
| Ga0137359_108672271 | 3300012923 | Vadose Zone Soil | MRNTGRQTRENRTITVDFQHETTSFQLLGDGKAFLECVLAFLFALGFQ |
| Ga0137419_117664801 | 3300012925 | Vadose Zone Soil | MGQAAKRTRENRTITVDFQDETTYFQLLGDTKAFVECVLAFLLAL |
| Ga0137416_121019562 | 3300012927 | Vadose Zone Soil | MGTTAKPTRENRTITIDFQNETTYFQLLGDGKAFVEWV |
| Ga0137404_100018796 | 3300012929 | Vadose Zone Soil | MCTAAKPTREDCTITVDFRDEATYFRLIEDGQAFVE* |
| Ga0137404_104487511 | 3300012929 | Vadose Zone Soil | MGTAAKPTRENRTITVDFRDDATYFHLIADGKAFVECVLAFLLALVLQL* |
| Ga0137404_113215122 | 3300012929 | Vadose Zone Soil | MRSTAHQTRENRTITVDFQNEATYFQLLGDGKAFVELV |
| Ga0137407_100124751 | 3300012930 | Vadose Zone Soil | MGTAAQPTRENRTITVDFRSEATYFQLLGNGQAFLECVIAFVMSLG |
| Ga0137407_100302721 | 3300012930 | Vadose Zone Soil | MGKAAKQTRENRTVTVDFRDEATYFQLLGDGKAFLACVLACLMALGFQLKH |
| Ga0137407_101891671 | 3300012930 | Vadose Zone Soil | LGTAATQTRYNRTITVDFQDETTYFRLLDDGQAFVEFVLAFFL |
| Ga0137407_103064871 | 3300012930 | Vadose Zone Soil | MRTTARQTRENRTITVDFQNEATYFQLLGDGKAFLEC |
| Ga0137407_106741921 | 3300012930 | Vadose Zone Soil | MSTAAKQTRTNRTITVDFRDEATYVQLLGDGKAFVECVCAFLLSLG |
| Ga0137407_119671591 | 3300012930 | Vadose Zone Soil | MRNTARQTRDNRSITVDFHHEATYVQLLGDGKTFVECVLA |
| Ga0137410_100867094 | 3300012944 | Vadose Zone Soil | MRNTTCQTRENRTITVDFHNEATSYQLLGDGKAFVECVLAFL |
| Ga0126375_105934511 | 3300012948 | Tropical Forest Soil | VKKATKRTRENRTITVDFRDEATYFHLLGDGKAFLECV |
| Ga0126375_106231161 | 3300012948 | Tropical Forest Soil | MGQAGKRTRHNRTITVDFHDEATYSQLLDNGKAFLECVL |
| Ga0126375_107754541 | 3300012948 | Tropical Forest Soil | MRSRAKQPRENRTITVDFQNEATYFQLLGDGKAFREFL |
| Ga0126375_108141601 | 3300012948 | Tropical Forest Soil | MRHTTKQPRANRTITIDFQNEATYFQLLGNRKAFLECVLAFI |
| Ga0126375_111328921 | 3300012948 | Tropical Forest Soil | MRTTASQTRENRTITVDFQNEATYGQLLGDGKAFVECVLAFLLALG |
| Ga0126375_113394621 | 3300012948 | Tropical Forest Soil | MSTAAKRTRENRTITVDFRDDATYAQLLGDGKAFV |
| Ga0126375_116991561 | 3300012948 | Tropical Forest Soil | MGTAAKPTRDDRTITVDFRDEATYFHLLSDGKTFLECVFAFLLALG |
| Ga0126375_117891791 | 3300012948 | Tropical Forest Soil | VKNTAKRTRENRTITVDFRDEATYFHLLGDGKAFLECV |
| Ga0126375_118077331 | 3300012948 | Tropical Forest Soil | MGTAAKSTRENRTITIDFQNETTYFQLLGDGKAFVECVLAFLLSLGLHLKHKAVVHSM* |
| Ga0126375_118185022 | 3300012948 | Tropical Forest Soil | MRNTARQTRENRTITIDFQNEATYVQLLGDGKAFLECVLAFVMSLGFQLKHK |
| Ga0126369_105109173 | 3300012971 | Tropical Forest Soil | VPKQARQTRENRTITIDFQNEATYFQLLGDGKAFLECVFAFLLSLGFQL |
| Ga0126369_110598581 | 3300012971 | Tropical Forest Soil | MGQAAKRTRQNRTITVDFQNEATYFQLLDNGKAFLEC |
| Ga0126369_114568381 | 3300012971 | Tropical Forest Soil | MSTAAQQTRTNRTITVDFRDEATYVQLLGDGKAFVECVCAFLL |
| Ga0126369_131321911 | 3300012971 | Tropical Forest Soil | MGQAAKRTRENRTITVDFRDDATYLQLLGNGKVVMSM* |
| Ga0126369_137054072 | 3300012971 | Tropical Forest Soil | MPNTASQTRENRTITIDFQNEATYFQLLGDGKAFLEFVFAFLLSMGF |
| Ga0164306_108900081 | 3300012988 | Soil | VKNTAKRTRENRTITVDFRDEATYFHLLGDGKAFLECVLAFMLSL |
| Ga0118560_1014811 | 3300013215 | Human Skin | MGNGTKTTRENRTITVDFHDESNYFQLICDGTAFV |
| Ga0163162_126130361 | 3300013306 | Switchgrass Rhizosphere | MDTTAKPTRDNRTITVDFQNKATYFQLLGDGKAFVECVLAFL |
| Ga0157375_105976761 | 3300013308 | Miscanthus Rhizosphere | MRTTARQTRENRTITVDFQNEATYFQLLGDGKAFVECV |
| Ga0075312_10761461 | 3300014254 | Natural And Restored Wetlands | MGQAAAQTRENRTITVDFHDESTYFQLLNDGKAFVEFVLA |
| Ga0075324_11215031 | 3300014263 | Natural And Restored Wetlands | MGQAAKATRQNRTITVDFQDESTYFQLIHDGKAFV |
| Ga0157379_104336364 | 3300014968 | Switchgrass Rhizosphere | MRNTAHPARENRTITVDLQNEATYIQLLSDGKAFVECVLACVLALGFQLKHKTTC |
| Ga0157379_110224491 | 3300014968 | Switchgrass Rhizosphere | MIEGDTLGTAAKPTRENRTITIDFRAEATYCRLLGDRKAFLECILAFLLSLG |
| Ga0157379_120817351 | 3300014968 | Switchgrass Rhizosphere | MRTTARQTRKNRTITVDFHNEATYFQLLGDGKAFVEFVLA |
| Ga0157376_119355711 | 3300014969 | Miscanthus Rhizosphere | MGQAGKRTRHNRTITVDFQNEATYFQLLGDGKAFVECVLAFLLALD |
| Ga0137418_105886502 | 3300015241 | Vadose Zone Soil | MRNTARQTRENRTITVDFHNEATYFQLLGDGKAFVECVLAFLLPLACS* |
| Ga0137418_107692912 | 3300015241 | Vadose Zone Soil | MRNTARQTRENRTLTVDLQNETIYFQLLGDGKAFVECVLAFLLALGFQRLSGNLVALLQ* |
| Ga0137409_101216301 | 3300015245 | Vadose Zone Soil | MRNTTRQTRENRTITVDFHNEATYYQLLGDGKAFVECVLAFLLALGFQ |
| Ga0137409_109227841 | 3300015245 | Vadose Zone Soil | MGIVAQPTRENRTITVDFRSEATYFQLLGNGKAFL |
| Ga0137409_112253251 | 3300015245 | Vadose Zone Soil | MRNTARQTRENRTLTVDFQNETTYFQLLGDGKAFVECVLAFLLA |
| Ga0137403_100359121 | 3300015264 | Vadose Zone Soil | MEQAGKRTRHNRTITVDFQNEATYFQLLGDGKVFVDCSR* |
| Ga0137403_100595073 | 3300015264 | Vadose Zone Soil | MRNPTRQTRENRTITVDFQHEATYFQLLGDGKAFLECVLAFVMALGF* |
| Ga0137403_112298882 | 3300015264 | Vadose Zone Soil | MGKASKQTRENRTITIDFQNEATYFQLLGDGKAFLECVFAFL |
| Ga0134085_103449891 | 3300015359 | Grasslands Soil | MRTTARQTRENRTITVNFQNEATYLQLLGDGKAFLECVLAFVMALG |
| Ga0132258_136109611 | 3300015371 | Arabidopsis Rhizosphere | MRNPARQTRENRAITIDFQNEATYVQLLGDGKAFLECVLAFVLALGLQLKHKAICGGGGC |
| Ga0132256_1012540132 | 3300015372 | Arabidopsis Rhizosphere | MGTTAKPTRENRTITVDCRSEATYFRLLGDGKAFLECVLAFVMSLGLQLKHKAMCH |
| Ga0132257_1001154471 | 3300015373 | Arabidopsis Rhizosphere | MIWGDTLGTAATPRRHNHTITVDFQDEVTYFRLLNDGKAFVEC |
| Ga0132257_1005087731 | 3300015373 | Arabidopsis Rhizosphere | MRHTTRQTRANRTLTVDFQTEATSLQLLGDGKACLAWVLAFLLALGFQLKPHATCRG |
| Ga0132257_1011425871 | 3300015373 | Arabidopsis Rhizosphere | MRNPTRQTRENRTITVDFQNEATYYRLLGDGKAFVE |
| Ga0132257_1031542591 | 3300015373 | Arabidopsis Rhizosphere | MRNTARQIRENRTITVDFHDEATYFRLIDDRKAFVEYVLAFLL |
| Ga0132257_1035598871 | 3300015373 | Arabidopsis Rhizosphere | MPHTTHPTRENRTITVDFQHEATYFQLLDDGKAFLEFVFAFLLALG |
| Ga0132257_1040053961 | 3300015373 | Arabidopsis Rhizosphere | MRHTARQTRENRTITIDFRNEATYFQLLGDGKALVEFVIAFILSLGFQLKHKA |
| Ga0182036_107213942 | 3300016270 | Soil | LGTAAKPTRENRTITVDFRDEATYCRLMGDGKAFLECVLAFLLS |
| Ga0182036_110781141 | 3300016270 | Soil | MQKTARQTRENRTITVDFQHEATYVQLLGDGKAFVEFV |
| Ga0182041_119578332 | 3300016294 | Soil | MRNTGHQTRENRTITVDFHNEATYYQLLGDGKAFVECVLAF |
| Ga0182035_121561521 | 3300016341 | Soil | MPKQARQTRDNRTITIDFQNEATYFQLLGDGKTFL |
| Ga0182040_110417772 | 3300016387 | Soil | MGQTAKATRANRTITVDFHNEATYGQFLDDTKAFVEC |
| Ga0182039_108962101 | 3300016422 | Soil | MRSRARQTRENRTITVDFQNEATYVQLLGDGKAFVECVCAFLLSLG |
| Ga0182038_113659371 | 3300016445 | Soil | MRNTARRTRENRTITVDFRSETTYVQLLDDGKAFLECI |
| Ga0184610_10090813 | 3300017997 | Groundwater Sediment | MRNTARKTRGNRTITVDFGDEATYFRLLGDGKAFVECVMAFIEGVQITV |
| Ga0184621_101752291 | 3300018054 | Groundwater Sediment | MGTGAKSTRENRTITVDFHNENNYFQVFEDGKAFLELL |
| Ga0184637_104884462 | 3300018063 | Groundwater Sediment | MCTAAKPTREDRTITVDFRDEATYFRLIEDGQAFVE |
| Ga0184618_101000541 | 3300018071 | Groundwater Sediment | MRSTVHQTRENRTITVDFQNEAPSFQLLGDGKAFLDSIGI |
| Ga0184609_100454445 | 3300018076 | Groundwater Sediment | MGTAAKPTRENRTITVDFQNETTYFQLLGDGKAFVECVLAFLLALVHCQAKIFC |
| Ga0184609_102287811 | 3300018076 | Groundwater Sediment | RNTARKTRGNRTITVNFGDEATYFRLLGDGKAFVECVMAFIEGVQITV |
| Ga0184609_102645523 | 3300018076 | Groundwater Sediment | MRNTARKTRGNRTITVNFGDEATYFRLLGDGKAFVECVMAFI |
| Ga0184612_100683531 | 3300018078 | Groundwater Sediment | MRATARQTRENRTITVDFQNEVTYFQLLGDGKAFLECVLAFLLT |
| Ga0184612_101174792 | 3300018078 | Groundwater Sediment | MGTAAKSTRENRTITIDFRDNATYFQLLGDGKAFLACVLAFVLSLGFQLKHK |
| Ga0184612_101184252 | 3300018078 | Groundwater Sediment | MRNTARKTRGNRTITVDFGDEATYFRLLGDGKAFVECVMAFIEGVQITL |
| Ga0184612_104663901 | 3300018078 | Groundwater Sediment | MGTAAKLTRDNRTITVDFQNEATYFQLLGDGKAFLECVLAFVMSLGFQ |
| Ga0184625_101642211 | 3300018081 | Groundwater Sediment | MGIVAQPTRENRTITVDFRNETTYLQLLDDGKAFV |
| Ga0184639_102650521 | 3300018082 | Groundwater Sediment | LGKAATQTRHNRTITVDFQDETTYFRLLDDGKAFV |
| Ga0190265_112183482 | 3300018422 | Soil | MQTTARQTRENRTITVDFQKEATYFHLLSDGKAFVELVIAFVM |
| Ga0066667_114004801 | 3300018433 | Grasslands Soil | MRKPARQTRENRTITVDFQNEATYFQLLGDGKAFLECVLAFVL |
| Ga0190268_116471141 | 3300018466 | Soil | MGTAAKRTRENRTITVDFRDDATYVELLGDGKAFVEFG |
| Ga0066669_120573931 | 3300018482 | Grasslands Soil | MGTAAKPTRENRTITVDFHDAVTYVQLLGDGKAFVECVLAFLLAL |
| Ga0190264_107715491 | 3300019377 | Soil | MCTAAKPTQEDRTITVDFRDEATYFRLIEIGQAFVE |
| Ga0137408_10934839 | 3300019789 | Vadose Zone Soil | MRNITRQTRENRTITVDFRSGATYFQRLGDGKAFLACVLAFVMSLGFQ |
| Ga0137408_12351425 | 3300019789 | Vadose Zone Soil | MGKAAKRPRHNRTITVDFHDEATYFQLLDDGKALVELVLAFI |
| Ga0137408_12669375 | 3300019789 | Vadose Zone Soil | MCTAAKPTREDCTITVDFRDEATYFRLIEDGQAFVE |
| Ga0137408_12756973 | 3300019789 | Vadose Zone Soil | MGKASKQTRVNRTITINFQNETTYVQLLGDGKAFLECVLA |
| Ga0137408_13654145 | 3300019789 | Vadose Zone Soil | MRNTARQTRENRTITIDFHNKATYFQLLGDGKAFVELVMAFILSIGFQLKHKATCDGEGA |
| Ga0179594_101565532 | 3300020170 | Vadose Zone Soil | MRNTAHQIRENRTIAVDFQNEETYLQLLADGRAFVELVMAFN |
| Ga0179594_102261822 | 3300020170 | Vadose Zone Soil | MRNTARQIRENRTITVDFRNEATDVQLLGDGKAFVECVVA |
| Ga0210378_101462603 | 3300021073 | Groundwater Sediment | MRTTACPTRENRTITVDFQNEATYFQLLGDGKAFLECVLAFLLA |
| Ga0210379_102275661 | 3300021081 | Groundwater Sediment | MGTAAKPTRENRTITVDFQHETTYVQLLGDGKAFVECI |
| Ga0179596_106866971 | 3300021086 | Vadose Zone Soil | MSTAAKPTRENRTITVDFQNETTYFQLLGDGKAFV |
| Ga0126371_110522021 | 3300021560 | Tropical Forest Soil | MRSQAKQPRANRTITVDFQHEATYFQLLGDGKAFLEFVFAFLLSLGF |
| Ga0126371_132847882 | 3300021560 | Tropical Forest Soil | VPKQARQTRENRTITIDFQNEATYCQLLGDGKAFLEFVFAFLLSLGFQLKHR |
| Ga0210113_11222761 | 3300025796 | Natural And Restored Wetlands | MGQAAAQTRENRTITVDFHDESTYFQLLNDGKALV |
| Ga0207660_114671301 | 3300025917 | Corn Rhizosphere | MAQDAKPTRHNRTITVDCHNEATFFALLSDGKAFIE |
| Ga0207662_104215442 | 3300025918 | Switchgrass Rhizosphere | MRNTARQIRENRTITVDFHDEATYFRLIDDRKAFVECVLAFLLALGFQHWPPTVA |
| Ga0207665_103536272 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHTARQTRENRTITVDFQNEATYYQLLGDGKAFIECVLAFL |
| Ga0207712_111447451 | 3300025961 | Switchgrass Rhizosphere | MRSKPRQTRENRTITVDFQNEATYVQLLGDGKAFVELVRFPWI |
| Ga0207677_102406863 | 3300026023 | Miscanthus Rhizosphere | MRNTTRQTRENRTITVDFHDEATYFRLIDDRKAFVECVLAFLLALGFQHWPPTVA |
| Ga0207708_115717071 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHTARQTRENRTITVNFQSEASYFQLLSDRKLFLECVLAFVLSLGFQLKHKATCR |
| Ga0207674_100517623 | 3300026116 | Corn Rhizosphere | MGTAAKPTRGNRTITVDFRDEATYFHLLSDGKAFLECVFAFLLST |
| Ga0207675_1006719502 | 3300026118 | Switchgrass Rhizosphere | MGKIATPTRVNRTITVDFQNEATYFHLLGNGKAFVECVLAFVLAKTMGHRVR |
| Ga0209152_100160722 | 3300026325 | Soil | MRTTACQPRENRTIAVDFQDETTYFQLLLNDGKAFVECVL |
| Ga0209152_104920792 | 3300026325 | Soil | MRNTARRTRDNRTITIDFQNEATYFQLLGDGKAFLECVLAFVL |
| Ga0209806_12435242 | 3300026529 | Soil | MGTASKQIRTNRTITIDFQNEATYFQLLGNGKAFLECVLAFVLSL |
| Ga0209156_101866493 | 3300026547 | Soil | MSTAAKRTRENRTITVDFRDEATYFELLGDGKAFLECVLAFVRSLD |
| Ga0209156_103677831 | 3300026547 | Soil | MEKAATPTRANRTITVDFQNEATYFQLLGDRKAFVECVLAFLLALGFQLLHKA |
| Ga0208712_1035012 | 3300026708 | Soil | MGPAAKPTRENRTITVDFQNEATYFQLLGDGKAFVECVLAFVL |
| Ga0209842_10613361 | 3300027379 | Groundwater Sand | MGKASKQTRENRTITIDFQNEATYFQLLGDGKAFLEFVFAFLLSLGLQLK |
| Ga0209899_10865211 | 3300027490 | Groundwater Sand | MRKPARPTRENRTITVDFQHEATYFQLLDDGKAFLEFV |
| Ga0209799_10111872 | 3300027654 | Tropical Forest Soil | MRHTTRQTRENRTITVDFHNEATYYQLLGERIDTMLVH |
| Ga0209388_12058161 | 3300027655 | Vadose Zone Soil | MGTAAKATRENRTIPVDFRDEATYFRLIEDGKAFVECVLAFLLVLGFQLKH |
| Ga0209689_10558764 | 3300027748 | Soil | MGTAAKPIRENRTITVDFRNEATYFQLLGDGKAFLECVMAFIK |
| Ga0209689_12645131 | 3300027748 | Soil | MGQAAKPTRENRTITIDFQNEATYFQLLGDGKAFLECVFAFLLSLGFQ |
| Ga0209814_105476962 | 3300027873 | Populus Rhizosphere | MRSTARQTRANRTITVDFQNEATYFQLLGDGKAFVEVVLA |
| Ga0209465_104296422 | 3300027874 | Tropical Forest Soil | MGQAAKRTRENRTITVDFRDDATYLQLLGNGKVVMSM |
| Ga0209283_101905722 | 3300027875 | Vadose Zone Soil | MEKAATPTRANRTITVDFHNEATYFQLLGDGKAFVECVLAFLLALGFQL |
| Ga0209481_107003432 | 3300027880 | Populus Rhizosphere | MRNSTHQTRTNRTITIDFHNEATYGQLLGDGKAFVECV |
| Ga0209481_107610661 | 3300027880 | Populus Rhizosphere | MGIAAKPTRANRTITVDFRDNATYFCLLADGKAFAWGS |
| Ga0209590_100243961 | 3300027882 | Vadose Zone Soil | MGTAAKPTRENRTITVDFQNETTYAHLLGDGKAFLEFVFAFLL |
| Ga0209590_101632305 | 3300027882 | Vadose Zone Soil | MRNTTRQTRENRTITVAFHNEATYFQLLGDGKACVECVVAFLLAL |
| Ga0209590_101989933 | 3300027882 | Vadose Zone Soil | MGTAAKPTRENRTITIDFHDEAAYFCLIDDEPVASFP |
| Ga0209590_104257951 | 3300027882 | Vadose Zone Soil | MRNTARQTRENRTITIDFQDETTYFPLLGDGKTFVALVIAFILSIGFQLKHKATCRGGGP |
| Ga0209590_105023851 | 3300027882 | Vadose Zone Soil | MRHTARQTRENRTITVDFQNEATYFQLLGDGKAFLECVLAFLFALGFQ |
| Ga0209590_108081511 | 3300027882 | Vadose Zone Soil | MAQAATRTRHNRTITLDFRDEATYVQLLSNGKAFVECVLAFLLALGFQL |
| Ga0209488_104558342 | 3300027903 | Vadose Zone Soil | MPQQARPPRENRTITVDFHNEATYFQLLGDGKAFVECVLAFLLPLACS |
| Ga0207428_101249041 | 3300027907 | Populus Rhizosphere | MRNTAHQTRENRTITIDFQNEATYFQLLGDGKAFLECVLAFVLSLGFQLKHKATCD |
| Ga0207428_101292993 | 3300027907 | Populus Rhizosphere | MGTAAKTTRGNRTITVDFRDEATYFHLLSDGKAFLECVFAFLLAFGFQ |
| Ga0209382_100874415 | 3300027909 | Populus Rhizosphere | MRNSTHQTRTNRTITIDFHNEATYGQLLGDGKAFVECVLAFVLALGFQ |
| Ga0209382_104757651 | 3300027909 | Populus Rhizosphere | MRNPARQTRENRTITVDFQNEATYFQLLGDGKAFLEC |
| Ga0268264_102126492 | 3300028381 | Switchgrass Rhizosphere | MRNTARQIRENRSITVDFHDEATYFRLIDDRKAFVECVLAFLLALGFQHWPPTVA |
| Ga0268264_121960231 | 3300028381 | Switchgrass Rhizosphere | MRNTARQTRDNRTITVDFRNEATYFQLLGDGKAFLECVLAFI |
| Ga0268264_126620062 | 3300028381 | Switchgrass Rhizosphere | MRSKPRQTRENRTITVDFQNEATYFQLLDDGKAFLECVLAFVISLG |
| Ga0307296_102870721 | 3300028819 | Soil | MRNTTHQTRENRTITVDFHNEATYYQLLGDGKAFVECVLAFLLALGFQLA |
| Ga0307278_100206712 | 3300028878 | Soil | MCTAAKPTPEDRTITVDFRDEATYFSLIEIGQAFVE |
| Ga0299907_102877532 | 3300030006 | Soil | MRNTTRQTRENRTITVDFQNEATYYQLLGDGKAFVECVLAFLLALGFQQSRELRSPVR |
| Ga0247648_10988942 | 3300030574 | Soil | MPNTARQTRENRTITVDFHNEATYLQILGDSKAFVECVLAFLLA |
| Ga0308206_10008875 | 3300030903 | Soil | MGTAAKPTRENRTITVDFQNETTYVQLLGDGKAFVEL |
| Ga0102746_105547402 | 3300031054 | Soil | MGTAAQPTRENRTTTVDFRSEATYFQLLGDGKAFLECVITFVMSLGFQLKHK |
| Ga0308197_101438962 | 3300031093 | Soil | MRTSARQTRANRTIPVDFHNEATSFRLLAHGQAWVAWV |
| Ga0307408_1018776832 | 3300031548 | Rhizosphere | MRNTARQTRDHRTITVDFHDEMTYLKLLDDRRAFVEF |
| Ga0310886_102249571 | 3300031562 | Soil | MIWGDTLGTAATPRRHNRTITVDFQDEATYFRLLNDGKAFVECV |
| Ga0310915_105053722 | 3300031573 | Soil | MRHTTKQPRANRTITVDFQNEATYFQLLGDRKAFLE |
| Ga0310915_109950701 | 3300031573 | Soil | MRHPTRQSRENRTLTVDFQNEATYLQLLGDGQAFLECVLAFLIALGF |
| Ga0318500_105380601 | 3300031724 | Soil | MHHTTKQPRVNRTITIDFQNEATYFQLLGDRKAFLECVLA |
| Ga0318501_108399341 | 3300031736 | Soil | MQNTARQTRENRTITVDFQHEATYVQLLGDGKAFVEFVIAFILSC |
| Ga0307468_1007002781 | 3300031740 | Hardwood Forest Soil | MRHTTKQPRANRTITIDFQNEATYFQLLGNRKAFLDCVLAFILSLGFQLAHKATCR |
| Ga0306918_112243762 | 3300031744 | Soil | MPNTARQPRENRTITVDFHNEATYLQLLGDGKAFLECVL |
| Ga0318509_108498082 | 3300031768 | Soil | MSTAAKRTRENRTITVDFQNEATYFQLLGDGKAFLECILA |
| Ga0318547_102368491 | 3300031781 | Soil | MRNTARQTRENRTITVDFQNEATYFQLLGDGKAFVDFV |
| Ga0318576_106316992 | 3300031796 | Soil | MRNTAHQTRENRTITIDFQNEATYMQLLGDGKAFLE |
| Ga0307473_105515092 | 3300031820 | Hardwood Forest Soil | MSTATKQTRENRTITVDFRNEATYVQLLGDGKAFVECV |
| Ga0307473_114636761 | 3300031820 | Hardwood Forest Soil | MRNTARQTRENRTITVDFQHEATYFQLLDDGKAFLECVFAFLLALGF |
| Ga0307413_101406311 | 3300031824 | Rhizosphere | MHHTTKQPRVNRTITIDFQNEATYFQLLGDRKAFLECVLAFILSIGFGRDPMFPVEM |
| Ga0310907_102243162 | 3300031847 | Soil | MIWGDTLGTAATPRRHNRTITVDFQDEATYFRLLNDGKAFVEC |
| Ga0310907_105499401 | 3300031847 | Soil | MGTAAKPTRVNRTITVDFQNETTYVQLLGDGRTFVECVLAFVHD |
| Ga0307410_108622492 | 3300031852 | Rhizosphere | MRTTTRQTRDNRTITVDFQNEATYFHLLGDGKAFVEL |
| Ga0307410_109844881 | 3300031852 | Rhizosphere | MPNTTRQTRENRTITIDFQNEATYVQLLGDGKAFVEFVIAFILSLGFQLKHKAMCSGGGC |
| Ga0306925_104200311 | 3300031890 | Soil | MRHPTRQSRENRTLTVDFQNEATYLQLLGDGQAFLECVLA |
| Ga0307406_109528731 | 3300031901 | Rhizosphere | MGTAAQPTRENRTITVDFRSEATYFQLLGDGKAFLECVIAFVLSLGF |
| Ga0310900_108676901 | 3300031908 | Soil | MIWGDTLGTAATPRRHNRTITVDFQDEATYFRLLNDGKAFV |
| Ga0306921_119433351 | 3300031912 | Soil | MRTTARQTRENRTITVDFQNEATSFRLLGDGKAFVECVLAF |
| Ga0306921_120546461 | 3300031912 | Soil | MRNPARQTRDNRTITVDFRSEATYFQLLGDGKAFLEC |
| Ga0310885_103339071 | 3300031943 | Soil | MGHTTIRTRENRTLTIDFRDEATYCRLIGDGKAFVAWVLAFVLT |
| Ga0310885_106836151 | 3300031943 | Soil | MRNTARQTRENRTLTIDFQNEATYFQLLGDGKAFLECVLAFVLSLG |
| Ga0310910_102271881 | 3300031946 | Soil | MHNTARQTRENRAITVDFRSEATYFQLLGDRNAFLECVLAFL |
| Ga0310910_107030192 | 3300031946 | Soil | VGAAAKPTRENRTITVDFRDDATYRRLLGDGKAFLECILAFILSLGF |
| Ga0310909_110731121 | 3300031947 | Soil | MRTTARQTRDNRTITVDFQNEVTYVQLLNDGKAFLECVLAFVMALG |
| Ga0310909_111109412 | 3300031947 | Soil | VKKTAKRTRENRTITVDFQDEATYFQLLGDGKAFLECV |
| Ga0307416_1002415371 | 3300032002 | Rhizosphere | MRSQAKQPRENRTITVDFQNEATYFQLLGDGKAFLEFVFA |
| Ga0307416_1018405422 | 3300032002 | Rhizosphere | MRNTAHQTRDNRTITIDFQNEATYFQLLGDGKAFVELVLAFILSIRVI |
| Ga0307414_103595912 | 3300032004 | Rhizosphere | MTMRNTARQTRDNRTITVDFQSEATYFQLLGDGKAFLEKD |
| Ga0307414_120583533 | 3300032004 | Rhizosphere | MRNTARQTRDHRTITVDFHDETTYLKLLDDRRAFVE |
| Ga0318504_106346552 | 3300032063 | Soil | MRNTARQTRENRTLTIDFQNEATYFQLLGDGKAFLECILAFVMSLGFQLK |
| Ga0306924_103375202 | 3300032076 | Soil | MRNTARQTRENRTITVDFRSEALYFQLLGDRKAFLECVLAF |
| Ga0307415_1006169163 | 3300032126 | Rhizosphere | MGIAAQPTRENRTITVDFRSEATYFQLLGDGKAFLECVL |
| Ga0307415_1019094572 | 3300032126 | Rhizosphere | MGTAAKPTRQNRTITIDFRNESTYFCLLKDGNAFVECVI |
| Ga0307415_1021308172 | 3300032126 | Rhizosphere | MGTAAQPTRANRTITVDFRSEATYFQLLGDGKAFLECVLAFVMS |
| Ga0307471_1036887461 | 3300032180 | Hardwood Forest Soil | MGQTAKTPRGNRTITVDFQDESTYFRLINDGKAFVECVLAFIL |
| Ga0307471_1036970011 | 3300032180 | Hardwood Forest Soil | MRNTAHQIRENRTITVDLQNEGTYLQLLADGRAFVELVELFLNKKEP |
| Ga0307471_1039090482 | 3300032180 | Hardwood Forest Soil | MGTAAQPTRENRTITVDFRSEATYFQRLGDRKAFLECVIAFGLSR |
| Ga0307472_1015295242 | 3300032205 | Hardwood Forest Soil | MGQAAKQTRENRTITVDFRDEATYFQLLGDGKAFLECILAFILS |
| Ga0306920_1000856111 | 3300032261 | Soil | MSTAAKRTRENRTITVDFRDEATYLQLLGDGKAFV |
| Ga0306920_1026545702 | 3300032261 | Soil | MRNTARQTRENRTLTIDFQNEATYFQLRGDGKAFLECILAFVMSLGF |
| Ga0214472_100115667 | 3300033407 | Soil | MPHTAKAPRENRTITVDFHDEATYSQLLGDTKAFIEFVLAFIL |
| Ga0314802_044072_371_514 | 3300034677 | Soil | MRNTTRQTRENRTITIDFHDEATYFRLIEDRKAFVECVLAFLLTLGFQ |
| Ga0370546_080636_3_131 | 3300034681 | Soil | MRNTTRQTRENRTITVDLHNEAPYAPLLGHGKAFIECVVAFLL |
| ⦗Top⦘ |