Metagenome / Metatranscriptome Family F002340

Basic Information
Family ID	F002340
Family Type	Metagenome / Metatranscriptome
Number of Sequences	569
Average Sequence Length	39 residues
Representative Sequence	MKTILSALVALSVIAGVAGSASALDAKTFYEQVDRDHN
Number of Associated Samples	136
Number of Associated Scaffolds	504

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	79.64 %
% of genes near scaffold ends (potentially truncated)	17.75 %
% of genes from short scaffolds (< 2000 bps)	72.76 %
Associated GOLD sequencing projects	121
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Bacteria (53.603 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (19.508 % of family members)
Environment Ontology (ENVO)	Unclassified (44.112 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (47.276 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 504 Family Scaffolds
PF00196	GerE	2.78
PF12770	CHAT	2.38
PF14333	DUF4389	1.98
PF00501	AMP-binding	1.19
PF06808	DctM	1.19
PF04519	Bactofilin	1.19
PF06463	Mob_synth_C	1.19
PF04392	ABC_sub_bind	1.19
PF04055	Radical_SAM	0.99
PF02515	CoA_transf_3	0.99
PF11695	DUF3291	0.99
PF03401	TctC	0.79
PF00589	Phage_integrase	0.79
PF01494	FAD_binding_3	0.60
PF13193	AMP-binding_C	0.60
PF13924	Lipocalin_5	0.60
PF00072	Response_reg	0.60
PF00106	adh_short	0.60
PF01979	Amidohydro_1	0.40
PF13545	HTH_Crp_2	0.40
PF05988	DUF899	0.40
PF03492	Methyltransf_7	0.40
PF13546	DDE_5	0.40
PF07045	DUF1330	0.40
PF05199	GMC_oxred_C	0.40
PF04290	DctQ	0.40
PF01565	FAD_binding_4	0.40
PF00528	BPD_transp_1	0.40
PF00239	Resolvase	0.40
PF13181	TPR_8	0.40
PF13424	TPR_12	0.40
PF08447	PAS_3	0.40
PF00496	SBP_bac_5	0.40
PF03781	FGE-sulfatase	0.40
PF04226	Transgly_assoc	0.40
PF13751	DDE_Tnp_1_6	0.40
PF07366	SnoaL	0.40
PF01925	TauE	0.20
PF08238	Sel1	0.20
PF09334	tRNA-synt_1g	0.20
PF14492	EFG_III	0.20
PF05139	Erythro_esteras	0.20
PF13472	Lipase_GDSL_2	0.20
PF03480	DctP	0.20
PF00156	Pribosyltran	0.20
PF01522	Polysacc_deac_1	0.20
PF01406	tRNA-synt_1e	0.20
PF00211	Guanylate_cyc	0.20
PF02668	TauD	0.20
PF00005	ABC_tran	0.20
PF02979	NHase_alpha	0.20
PF13428	TPR_14	0.20
PF03070	TENA_THI-4	0.20
PF12681	Glyoxalase_2	0.20
PF02518	HATPase_c	0.20
PF03972	MmgE_PrpD	0.20
PF13367	PrsW-protease	0.20
PF01548	DEDD_Tnp_IS110	0.20
PF00441	Acyl-CoA_dh_1	0.20
PF01266	DAO	0.20
PF13231	PMT_2	0.20
PF00561	Abhydrolase_1	0.20
PF13426	PAS_9	0.20
PF12399	BCA_ABC_TP_C	0.20
PF05226	CHASE2	0.20
PF00042	Globin	0.20
PF14319	Zn_Tnp_IS91	0.20
PF00596	Aldolase_II	0.20
PF07364	DUF1485	0.20
PF00270	DEAD	0.20
PF03232	COQ7	0.20
PF12706	Lactamase_B_2	0.20
PF13671	AAA_33	0.20
PF03600	CitMHS	0.20
PF04828	GFA	0.20
PF02082	Rrf2	0.20
PF05231	MASE1	0.20
PF12697	Abhydrolase_6	0.20
PF13188	PAS_8	0.20
PF06826	Asp-Al_Ex	0.20
PF00941	FAD_binding_5	0.20
PF02585	PIG-L	0.20
PF13458	Peripla_BP_6	0.20
PF13432	TPR_16	0.20
PF14833	NAD_binding_11	0.20
PF00583	Acetyltransf_1	0.20
PF03129	HGTP_anticodon	0.20
PF07859	Abhydrolase_3	0.20
PF11578	DUF3237	0.20
PF00903	Glyoxalase	0.20
PF01546	Peptidase_M20	0.20
PF07681	DoxX	0.20
PF00080	Sod_Cu	0.20
PF13620	CarboxypepD_reg	0.20
PF04972	BON	0.20
PF13360	PQQ_2	0.20
PF04986	Y2_Tnp	0.20
PF12728	HTH_17	0.20
PF07536	HWE_HK	0.20
PF14031	D-ser_dehydrat	0.20
PF13361	UvrD_C	0.20
PF11775	CobT_C	0.20
PF02096	60KD_IMP	0.20
PF01547	SBP_bac_1	0.20
PF07298	NnrU	0.20
PF12904	Collagen_bind_2	0.20
PF13676	TIR_2	0.20
PF07690	MFS_1	0.20
PF13442	Cytochrome_CBB3	0.20
PF03928	HbpS-like	0.20
PF12833	HTH_18	0.20
PF13495	Phage_int_SAM_4	0.20
PF13185	GAF_2	0.20
PF12802	MarR_2	0.20
PF01478	Peptidase_A24	0.20
PF03779	SPW	0.20
PF01243	Putative_PNPOx	0.20
PF00656	Peptidase_C14	0.20
PF02673	BacA	0.20
PF01554	MatE	0.20
PF03328	HpcH_HpaI	0.20
PF12860	PAS_7	0.20
PF00296	Bac_luciferase	0.20
PF00202	Aminotran_3	0.20
PF12395	DUF3658	0.20
PF02913	FAD-oxidase_C	0.20
PF03466	LysR_substrate	0.20
PF00702	Hydrolase	0.20

COG ID	Name	Functional Category	% Frequency in 504 Family Scaffolds
COG1664	Cytoskeletal protein CcmA, bactofilin family	Cytoskeleton [Z]	1.19
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	1.19
COG2896	GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA)	Coenzyme transport and metabolism [H]	1.19
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.19
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	0.99
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.79
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.60
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.60
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.60
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	0.40
COG1262	Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain	Posttranslational modification, protein turnover, chaperones [O]	0.40
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.40
COG0018	Arginyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.40
COG2303	Choline dehydrogenase or related flavoprotein	Lipid transport and metabolism [I]	0.40
COG2261	Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family	General function prediction only [R]	0.40
COG4312	Predicted dithiol-disulfide oxidoreductase, DUF899 family	General function prediction only [R]	0.40
COG0215	Cysteinyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.40
COG0143	Methionyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.40
COG5470	Uncharacterized conserved protein, DUF1330 family	Function unknown [S]	0.40
COG2378	Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains	Transcription [K]	0.20
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.20
COG2312	Erythromycin esterase homolog	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.20
COG2524	Predicted transcriptional regulator, contains C-terminal CBS domains	Transcription [K]	0.20
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	0.20
COG2941	Demethoxyubiquinone hydroxylase, CLK1/Coq7/Cat5 family (ubiquinone biosynthesis)	Coenzyme transport and metabolism [H]	0.20
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.20
COG2985	Uncharacterized membrane protein YbjL, putative transporter	General function prediction only [R]	0.20
COG3447	Integral membrane sensor domain MASE1	Signal transduction mechanisms [T]	0.20
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	0.20
COG3791	Uncharacterized conserved protein	Function unknown [S]	0.20
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	0.20
COG3851	Signal transduction histidine kinase UhpB, glucose-6-phosphate specific	Signal transduction mechanisms [T]	0.20
COG3920	Two-component sensor histidine kinase, HisKA and HATPase domains	Signal transduction mechanisms [T]	0.20
COG4094	Uncharacterized membrane protein	Function unknown [S]	0.20
COG4249	Uncharacterized conserved protein, contains caspase domain	General function prediction only [R]	0.20
COG4251	Bacteriophytochrome (light-regulated signal transduction histidine kinase)	Signal transduction mechanisms [T]	0.20
COG4252	Extracytoplasmic sensor domain CHASE2 (specificity unknown)	Signal transduction mechanisms [T]	0.20
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.20
COG5476	Microcystin degradation protein MlrC, contains DUF1485 domain	General function prediction only [R]	0.20
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	0.20
COG0060	Isoleucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.20
COG0124	Histidyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.20
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.20
COG0423	Glycyl-tRNA synthetase, class II	Translation, ribosomal structure and biogenesis [J]	0.20
COG0441	Threonyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.20
COG0442	Prolyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.20
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.20
COG0495	Leucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.20
COG0525	Valyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.20
COG0640	DNA-binding transcriptional regulator, ArsR family	Transcription [K]	0.20
COG0642	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.20
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	0.20
COG0706	Membrane protein insertase Oxa1/YidC/SpoIIIJ	Cell wall/membrane/envelope biogenesis [M]	0.20
COG2188	DNA-binding transcriptional regulator, GntR family	Transcription [K]	0.20
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	0.20
COG1017	Hemoglobin-like flavoprotein	Energy production and conversion [C]	0.20
COG1414	DNA-binding transcriptional regulator, IclR family	Transcription [K]	0.20
COG1725	DNA-binding transcriptional regulator YhcF, GntR family	Transcription [K]	0.20
COG1959	DNA-binding transcriptional regulator, IscR family	Transcription [K]	0.20
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.20
COG1968	Undecaprenyl pyrophosphate phosphatase	Lipid transport and metabolism [I]	0.20
COG2032	Cu/Zn superoxide dismutase	Inorganic ion transport and metabolism [P]	0.20
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.20
COG2120	N-acetylglucosaminyl deacetylase, LmbE family	Carbohydrate transport and metabolism [G]	0.20
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.20
COG2175	Taurine dioxygenase, alpha-ketoglutarate-dependent	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.20
COG2186	DNA-binding transcriptional regulator, FadR family	Transcription [K]	0.20

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	53.78 %
Unclassified	root	N/A	46.22 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	53.78 %
Unclassified	root	N/A	46.22 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	53.60 %
Unclassified	root	N/A	46.22 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.22 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	38.49 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.53 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.18 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.18 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.22 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	31.11 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.53 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.18 %
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	0.18 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.18 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.22 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	20.74 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	2.28 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.88 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.53 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.18 %
Dinophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	0.18 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	0.18 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.22 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	5.27 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.28 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2.28 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	1.05 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.88 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.53 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.18 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	0.18 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.18 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.18 %
Suessiales	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales	0.18 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.35 %
Kineosporiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.22 %
unclassified Hyphomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae	3.69 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.28 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.58 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.05 %
unclassified Rhodobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae	0.88 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	0.53 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.53 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.18 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.18 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.18 %
Verrucomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae	0.18 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	0.18 %
Symbiodiniaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae	0.18 %
Kineosporiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae	0.35 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.22 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	3.69 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.28 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.05 %
Rhodobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	0.88 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.53 %
unclassified Variovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax	0.18 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.18 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	0.18 %
unclassified Verrucomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae	0.18 %
Bradyrhizobium jicamae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae	0.18 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.18 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.18 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.18 %
Kineosporia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia	0.35 %
unclassified Microvirga	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga	0.35 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.22 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	3.69 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.28 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.05 %
Rhodobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	0.88 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.53 %
Variovorax sp. OV329	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. OV329	0.18 %
Bradyrhizobium sp. 38	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 38	0.18 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.18 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.18 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.18 %
Bradyrhizobium sp. 1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1	0.18 %
Bradyrhizobium jicamae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae	0.18 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.18 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.18 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.18 %
Microvirga sp. KLBC 81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. KLBC 81	0.35 %
unclassified Kineosporia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → unclassified Kineosporia	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.22 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	3.69 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.28 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.05 %
Rhodobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	0.88 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.53 %
Variovorax sp. OV329	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. OV329	0.18 %
Bradyrhizobium sp. 38	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 38	0.18 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.18 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.18 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.18 %
Bradyrhizobium sp. 1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1	0.18 %
Bradyrhizobium jicamae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae	0.18 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.18 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.18 %
Rhodomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	0.18 %
Kineosporia sp. A_224	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → unclassified Kineosporia → Kineosporia sp. A_224	0.35 %
Microvirga sp. KLBC 81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. KLBC 81	0.35 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000363\|ICChiseqgaiiFebDRAFT_13262400	Not Available	545	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100343575	Not Available	671	Open in IMG/M
3300000550\|F24TB_10070305	Not Available	803	Open in IMG/M
3300000550\|F24TB_11817900	Not Available	855	Open in IMG/M
3300000787\|JGI11643J11755_10693538	Not Available	605	Open in IMG/M
3300000858\|JGI10213J12805_10006612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1562	Open in IMG/M
3300000858\|JGI10213J12805_10006612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1562	Open in IMG/M
3300000858\|JGI10213J12805_10222683	Not Available	565	Open in IMG/M
3300000858\|JGI10213J12805_10782974	All Organisms → cellular organisms → Bacteria	1247	Open in IMG/M
3300000858\|JGI10213J12805_10782974	All Organisms → cellular organisms → Bacteria	1247	Open in IMG/M
3300000858\|JGI10213J12805_11558494	Not Available	556	Open in IMG/M
3300001431\|F14TB_101152806	Not Available	622	Open in IMG/M
3300001431\|F14TB_101466494	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1414	Open in IMG/M
3300001431\|F14TB_101758272	Not Available	887	Open in IMG/M
3300003659\|JGI25404J52841_10101905	Not Available	602	Open in IMG/M
3300003725\|Ga0008087_108360	Not Available	610	Open in IMG/M
3300003725\|Ga0008087_108360	Not Available	610	Open in IMG/M
3300004268\|Ga0066398_10196391	Not Available	530	Open in IMG/M
3300004281\|Ga0066397_10008223	All Organisms → cellular organisms → Bacteria	1265	Open in IMG/M
3300004281\|Ga0066397_10074263	Not Available	666	Open in IMG/M
3300004281\|Ga0066397_10074263	Not Available	666	Open in IMG/M
3300004479\|Ga0062595_100033986	All Organisms → cellular organisms → Bacteria → Proteobacteria	2139	Open in IMG/M
3300004479\|Ga0062595_100045164	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1964	Open in IMG/M
3300005093\|Ga0062594_100591611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	969	Open in IMG/M
3300005332\|Ga0066388_100037017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	4736	Open in IMG/M
3300005332\|Ga0066388_100057716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4073	Open in IMG/M
3300005332\|Ga0066388_100462456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	1909	Open in IMG/M
3300005332\|Ga0066388_100737708	All Organisms → cellular organisms → Bacteria	1586	Open in IMG/M
3300005332\|Ga0066388_101017711	Not Available	1390	Open in IMG/M
3300005332\|Ga0066388_102566672	Not Available	927	Open in IMG/M
3300005332\|Ga0066388_103697723	Not Available	781	Open in IMG/M
3300005332\|Ga0066388_103867629	Not Available	764	Open in IMG/M
3300005332\|Ga0066388_105818584	Not Available	623	Open in IMG/M
3300005332\|Ga0066388_106764392	Not Available	577	Open in IMG/M
3300005334\|Ga0068869_101223632	Not Available	661	Open in IMG/M
3300005455\|Ga0070663_100302383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	1281	Open in IMG/M
3300005536\|Ga0070697_100525962	All Organisms → cellular organisms → Bacteria	1036	Open in IMG/M
3300005545\|Ga0070695_100011311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5338	Open in IMG/M
3300005549\|Ga0070704_100741440	Not Available	874	Open in IMG/M
3300005713\|Ga0066905_100000836	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9609	Open in IMG/M
3300005713\|Ga0066905_100003435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6230	Open in IMG/M
3300005713\|Ga0066905_100007740	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	4835	Open in IMG/M
3300005713\|Ga0066905_100010599	All Organisms → cellular organisms → Bacteria	4357	Open in IMG/M
3300005713\|Ga0066905_100010599	All Organisms → cellular organisms → Bacteria	4357	Open in IMG/M
3300005713\|Ga0066905_100022049	All Organisms → cellular organisms → Bacteria	3417	Open in IMG/M
3300005713\|Ga0066905_100022049	All Organisms → cellular organisms → Bacteria	3417	Open in IMG/M
3300005713\|Ga0066905_100032908	All Organisms → cellular organisms → Bacteria	2968	Open in IMG/M
3300005713\|Ga0066905_100035361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2893	Open in IMG/M
3300005713\|Ga0066905_100048214	All Organisms → cellular organisms → Bacteria	2586	Open in IMG/M
3300005713\|Ga0066905_100048214	All Organisms → cellular organisms → Bacteria	2586	Open in IMG/M
3300005713\|Ga0066905_100065615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	2308	Open in IMG/M
3300005713\|Ga0066905_100066301	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2299	Open in IMG/M
3300005713\|Ga0066905_100072363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	2225	Open in IMG/M
3300005713\|Ga0066905_100084847	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2095	Open in IMG/M
3300005713\|Ga0066905_100098488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1978	Open in IMG/M
3300005713\|Ga0066905_100099282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1972	Open in IMG/M
3300005713\|Ga0066905_100100621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1961	Open in IMG/M
3300005713\|Ga0066905_100104374	Not Available	1933	Open in IMG/M
3300005713\|Ga0066905_100112382	All Organisms → cellular organisms → Bacteria	1879	Open in IMG/M
3300005713\|Ga0066905_100121617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium	1823	Open in IMG/M
3300005713\|Ga0066905_100133829	All Organisms → cellular organisms → Bacteria	1756	Open in IMG/M
3300005713\|Ga0066905_100133898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1755	Open in IMG/M
3300005713\|Ga0066905_100133898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1755	Open in IMG/M
3300005713\|Ga0066905_100135361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	1748	Open in IMG/M
3300005713\|Ga0066905_100141123	All Organisms → cellular organisms → Bacteria → Proteobacteria	1719	Open in IMG/M
3300005713\|Ga0066905_100168893	All Organisms → cellular organisms → Bacteria → Proteobacteria	1599	Open in IMG/M
3300005713\|Ga0066905_100174023	All Organisms → cellular organisms → Bacteria	1580	Open in IMG/M
3300005713\|Ga0066905_100212188	Not Available	1457	Open in IMG/M
3300005713\|Ga0066905_100213455	All Organisms → cellular organisms → Bacteria → Proteobacteria	1453	Open in IMG/M
3300005713\|Ga0066905_100230459	All Organisms → cellular organisms → Bacteria	1408	Open in IMG/M
3300005713\|Ga0066905_100239752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	1385	Open in IMG/M
3300005713\|Ga0066905_100239752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	1385	Open in IMG/M
3300005713\|Ga0066905_100239752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	1385	Open in IMG/M
3300005713\|Ga0066905_100296572	Not Available	1267	Open in IMG/M
3300005713\|Ga0066905_100296572	Not Available	1267	Open in IMG/M
3300005713\|Ga0066905_100320879	All Organisms → cellular organisms → Bacteria	1225	Open in IMG/M
3300005713\|Ga0066905_100343739	Not Available	1189	Open in IMG/M
3300005713\|Ga0066905_100346602	Not Available	1185	Open in IMG/M
3300005713\|Ga0066905_100366780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1156	Open in IMG/M
3300005713\|Ga0066905_100366780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1156	Open in IMG/M
3300005713\|Ga0066905_100366780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1156	Open in IMG/M
3300005713\|Ga0066905_100412120	All Organisms → cellular organisms → Bacteria → Proteobacteria	1099	Open in IMG/M
3300005713\|Ga0066905_100451790	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1057	Open in IMG/M
3300005713\|Ga0066905_100470030	Not Available	1038	Open in IMG/M
3300005713\|Ga0066905_100501118	All Organisms → cellular organisms → Bacteria	1009	Open in IMG/M
3300005713\|Ga0066905_100512813	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	999	Open in IMG/M
3300005713\|Ga0066905_100592981	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → unclassified Kineosporia → Kineosporia sp. A_224	937	Open in IMG/M
3300005713\|Ga0066905_100592981	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → unclassified Kineosporia → Kineosporia sp. A_224	937	Open in IMG/M
3300005713\|Ga0066905_100597826	All Organisms → cellular organisms → Bacteria	933	Open in IMG/M
3300005713\|Ga0066905_100603553	Not Available	929	Open in IMG/M
3300005713\|Ga0066905_100603553	Not Available	929	Open in IMG/M
3300005713\|Ga0066905_100631988	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	910	Open in IMG/M
3300005713\|Ga0066905_100661705	All Organisms → cellular organisms → Bacteria	892	Open in IMG/M
3300005713\|Ga0066905_100775905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	829	Open in IMG/M
3300005713\|Ga0066905_101008963	Not Available	734	Open in IMG/M
3300005713\|Ga0066905_101123396	Not Available	699	Open in IMG/M
3300005713\|Ga0066905_101708576	Not Available	578	Open in IMG/M
3300005713\|Ga0066905_101708576	Not Available	578	Open in IMG/M
3300005713\|Ga0066905_101815499	Not Available	563	Open in IMG/M
3300005713\|Ga0066905_101855868	Not Available	557	Open in IMG/M
3300005713\|Ga0066905_101873927	Not Available	554	Open in IMG/M
3300005713\|Ga0066905_102083339	Not Available	527	Open in IMG/M
3300005713\|Ga0066905_102197100	Not Available	515	Open in IMG/M
3300005713\|Ga0066905_102217041	Not Available	512	Open in IMG/M
3300005713\|Ga0066905_102217041	Not Available	512	Open in IMG/M
3300005713\|Ga0066905_102303825	Not Available	503	Open in IMG/M
3300005713\|Ga0066905_102324948	Not Available	501	Open in IMG/M
3300005713\|Ga0066905_102324948	Not Available	501	Open in IMG/M
3300005719\|Ga0068861_100027039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4175	Open in IMG/M
3300005719\|Ga0068861_100123459	All Organisms → cellular organisms → Bacteria	2092	Open in IMG/M
3300005719\|Ga0068861_100212864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1629	Open in IMG/M
3300005719\|Ga0068861_101416898	Not Available	679	Open in IMG/M
3300005719\|Ga0068861_101416898	Not Available	679	Open in IMG/M
3300005719\|Ga0068861_102126314	Not Available	561	Open in IMG/M
3300005719\|Ga0068861_102126314	Not Available	561	Open in IMG/M
3300005764\|Ga0066903_100053584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	4947	Open in IMG/M
3300005764\|Ga0066903_100060728	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4722	Open in IMG/M
3300005764\|Ga0066903_100065809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4582	Open in IMG/M
3300005764\|Ga0066903_100106305	All Organisms → cellular organisms → Bacteria → Proteobacteria	3821	Open in IMG/M
3300005764\|Ga0066903_100131041	All Organisms → cellular organisms → Bacteria → Proteobacteria	3526	Open in IMG/M
3300005764\|Ga0066903_100204495	All Organisms → cellular organisms → Bacteria	2961	Open in IMG/M
3300005764\|Ga0066903_100301070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2537	Open in IMG/M
3300005764\|Ga0066903_100301070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2537	Open in IMG/M
3300005764\|Ga0066903_100456447	All Organisms → cellular organisms → Bacteria	2139	Open in IMG/M
3300005764\|Ga0066903_100686969	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	1800	Open in IMG/M
3300005764\|Ga0066903_100863703	Not Available	1630	Open in IMG/M
3300005764\|Ga0066903_101106134	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1461	Open in IMG/M
3300005764\|Ga0066903_101157585	Not Available	1432	Open in IMG/M
3300005764\|Ga0066903_101157585	Not Available	1432	Open in IMG/M
3300005764\|Ga0066903_101187330	All Organisms → cellular organisms → Bacteria → Proteobacteria	1415	Open in IMG/M
3300005764\|Ga0066903_101249463	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1383	Open in IMG/M
3300005764\|Ga0066903_101249463	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1383	Open in IMG/M
3300005764\|Ga0066903_101249463	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1383	Open in IMG/M
3300005764\|Ga0066903_102792179	Not Available	947	Open in IMG/M
3300005764\|Ga0066903_103279919	All Organisms → cellular organisms → Bacteria	875	Open in IMG/M
3300005764\|Ga0066903_103539371	Not Available	841	Open in IMG/M
3300005764\|Ga0066903_106565388	Not Available	606	Open in IMG/M
3300005764\|Ga0066903_106690813	Not Available	599	Open in IMG/M
3300005764\|Ga0066903_107539246	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	561	Open in IMG/M
3300005843\|Ga0068860_102781867	Not Available	507	Open in IMG/M
3300005937\|Ga0081455_10000052	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	123035	Open in IMG/M
3300005937\|Ga0081455_10000053	All Organisms → cellular organisms → Bacteria → Proteobacteria	122071	Open in IMG/M
3300005937\|Ga0081455_10000087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	99627	Open in IMG/M
3300005937\|Ga0081455_10000087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	99627	Open in IMG/M
3300005937\|Ga0081455_10000412	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	56264	Open in IMG/M
3300005937\|Ga0081455_10000994	All Organisms → cellular organisms → Bacteria	35958	Open in IMG/M
3300005937\|Ga0081455_10008681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	10527	Open in IMG/M
3300005937\|Ga0081455_10030979	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4848	Open in IMG/M
3300005937\|Ga0081455_10041954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae	4019	Open in IMG/M
3300005983\|Ga0081540_1000071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	109611	Open in IMG/M
3300005983\|Ga0081540_1000071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	109611	Open in IMG/M
3300005983\|Ga0081540_1000148	All Organisms → cellular organisms → Bacteria → Proteobacteria	72453	Open in IMG/M
3300005983\|Ga0081540_1000205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	61689	Open in IMG/M
3300005983\|Ga0081540_1000515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	37910	Open in IMG/M
3300005983\|Ga0081540_1000794	All Organisms → cellular organisms → Bacteria → Proteobacteria	28989	Open in IMG/M
3300005983\|Ga0081540_1001096	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	23968	Open in IMG/M
3300005983\|Ga0081540_1053695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1974	Open in IMG/M
3300005983\|Ga0081540_1070488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1618	Open in IMG/M
3300005983\|Ga0081540_1070488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1618	Open in IMG/M
3300005983\|Ga0081540_1165945	All Organisms → cellular organisms → Bacteria	849	Open in IMG/M
3300006049\|Ga0075417_10235465	Not Available	875	Open in IMG/M
3300006163\|Ga0070715_10010800	All Organisms → cellular organisms → Bacteria	3266	Open in IMG/M
3300006163\|Ga0070715_10184996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1047	Open in IMG/M
3300006163\|Ga0070715_10184996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1047	Open in IMG/M
3300006173\|Ga0070716_100505718	Not Available	892	Open in IMG/M
3300006175\|Ga0070712_100853606	Not Available	783	Open in IMG/M
3300006196\|Ga0075422_10028674	All Organisms → cellular organisms → Bacteria	1929	Open in IMG/M
3300006196\|Ga0075422_10032913	All Organisms → cellular organisms → Bacteria	1816	Open in IMG/M
3300006196\|Ga0075422_10044349	All Organisms → cellular organisms → Bacteria → Proteobacteria	1593	Open in IMG/M
3300006196\|Ga0075422_10116624	All Organisms → cellular organisms → Bacteria	1039	Open in IMG/M
3300006196\|Ga0075422_10444806	Not Available	580	Open in IMG/M
3300006196\|Ga0075422_10491540	Not Available	555	Open in IMG/M
3300006755\|Ga0079222_10052102	All Organisms → cellular organisms → Bacteria → Proteobacteria	1908	Open in IMG/M
3300006755\|Ga0079222_10441289	Not Available	926	Open in IMG/M
3300006755\|Ga0079222_10776033	Not Available	777	Open in IMG/M
3300006755\|Ga0079222_10832079	Not Available	760	Open in IMG/M
3300006755\|Ga0079222_10872021	Not Available	749	Open in IMG/M
3300006755\|Ga0079222_11140728	Not Available	690	Open in IMG/M
3300006844\|Ga0075428_100012055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	9617	Open in IMG/M
3300006844\|Ga0075428_100041676	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5047	Open in IMG/M
3300006844\|Ga0075428_100204444	Not Available	2134	Open in IMG/M
3300006844\|Ga0075428_100263969	Not Available	1854	Open in IMG/M
3300006844\|Ga0075428_100537027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1250	Open in IMG/M
3300006844\|Ga0075428_100684579	Not Available	1093	Open in IMG/M
3300006844\|Ga0075428_102010739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	599	Open in IMG/M
3300006844\|Ga0075428_102083683	Not Available	587	Open in IMG/M
3300006847\|Ga0075431_100160045	All Organisms → cellular organisms → Bacteria	2315	Open in IMG/M
3300006852\|Ga0075433_10001436	All Organisms → cellular organisms → Bacteria → Proteobacteria	17569	Open in IMG/M
3300006852\|Ga0075433_10003351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	12384	Open in IMG/M
3300006852\|Ga0075433_10005438	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	10007	Open in IMG/M
3300006852\|Ga0075433_10013326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6680	Open in IMG/M
3300006852\|Ga0075433_10251082	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1569	Open in IMG/M
3300006852\|Ga0075433_10322482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1367	Open in IMG/M
3300006852\|Ga0075433_10358213	All Organisms → cellular organisms → Bacteria → Proteobacteria	1289	Open in IMG/M
3300006852\|Ga0075433_11829876	Not Available	522	Open in IMG/M
3300006854\|Ga0075425_100004320	All Organisms → cellular organisms → Bacteria	14642	Open in IMG/M
3300006854\|Ga0075425_100116758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3044	Open in IMG/M
3300006854\|Ga0075425_100811137	Not Available	1072	Open in IMG/M
3300006871\|Ga0075434_100012676	All Organisms → cellular organisms → Bacteria	7995	Open in IMG/M
3300006871\|Ga0075434_102173728	Not Available	559	Open in IMG/M
3300006871\|Ga0075434_102576843	Not Available	509	Open in IMG/M
3300006880\|Ga0075429_101645771	Not Available	558	Open in IMG/M
3300006903\|Ga0075426_10215498	Not Available	1393	Open in IMG/M
3300006904\|Ga0075424_100001322	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	21594	Open in IMG/M
3300006904\|Ga0075424_100098196	All Organisms → cellular organisms → Bacteria	3085	Open in IMG/M
3300006904\|Ga0075424_100929951	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	927	Open in IMG/M
3300006904\|Ga0075424_102052612	Not Available	603	Open in IMG/M
3300006904\|Ga0075424_102573539	Not Available	532	Open in IMG/M
3300006937\|Ga0081243_1008363	Not Available	528	Open in IMG/M
3300006954\|Ga0079219_10111011	Not Available	1372	Open in IMG/M
3300006954\|Ga0079219_10618689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. KLBC 81	798	Open in IMG/M
3300006954\|Ga0079219_11409481	Not Available	623	Open in IMG/M
3300009081\|Ga0105098_10288198	Not Available	785	Open in IMG/M
3300009094\|Ga0111539_10010044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	11930	Open in IMG/M
3300009094\|Ga0111539_10014925	All Organisms → cellular organisms → Bacteria	9681	Open in IMG/M
3300009094\|Ga0111539_10162935	All Organisms → cellular organisms → Bacteria	2608	Open in IMG/M
3300009094\|Ga0111539_10167767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 38	2565	Open in IMG/M
3300009094\|Ga0111539_10186565	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2422	Open in IMG/M
3300009094\|Ga0111539_10193572	Not Available	2372	Open in IMG/M
3300009094\|Ga0111539_10257410	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2032	Open in IMG/M
3300009094\|Ga0111539_10303627	Not Available	1857	Open in IMG/M
3300009094\|Ga0111539_10420089	All Organisms → cellular organisms → Bacteria → Proteobacteria	1557	Open in IMG/M
3300009094\|Ga0111539_10495678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1423	Open in IMG/M
3300009094\|Ga0111539_10640434	Not Available	1238	Open in IMG/M
3300009094\|Ga0111539_10692131	All Organisms → cellular organisms → Bacteria	1187	Open in IMG/M
3300009094\|Ga0111539_11639659	Not Available	746	Open in IMG/M
3300009094\|Ga0111539_12318382	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	623	Open in IMG/M
3300009094\|Ga0111539_12385205	Not Available	614	Open in IMG/M
3300009098\|Ga0105245_11975691	Not Available	637	Open in IMG/M
3300009100\|Ga0075418_10033939	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5545	Open in IMG/M
3300009100\|Ga0075418_10055276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	4248	Open in IMG/M
3300009100\|Ga0075418_10451544	All Organisms → cellular organisms → Bacteria	1377	Open in IMG/M
3300009100\|Ga0075418_10569956	Not Available	1218	Open in IMG/M
3300009100\|Ga0075418_10569956	Not Available	1218	Open in IMG/M
3300009100\|Ga0075418_11086436	Not Available	866	Open in IMG/M
3300009100\|Ga0075418_12241090	Not Available	596	Open in IMG/M
3300009100\|Ga0075418_12662887	Not Available	546	Open in IMG/M
3300009146\|Ga0105091_10124937	All Organisms → cellular organisms → Bacteria	1194	Open in IMG/M
3300009146\|Ga0105091_10470751	Not Available	634	Open in IMG/M
3300009147\|Ga0114129_10068788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4936	Open in IMG/M
3300009147\|Ga0114129_10179324	All Organisms → cellular organisms → Bacteria	2884	Open in IMG/M
3300009147\|Ga0114129_10194890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2748	Open in IMG/M
3300009147\|Ga0114129_10332303	Not Available	2017	Open in IMG/M
3300009147\|Ga0114129_12409927	Not Available	630	Open in IMG/M
3300009156\|Ga0111538_10070340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4456	Open in IMG/M
3300009156\|Ga0111538_10155527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2904	Open in IMG/M
3300009156\|Ga0111538_10238009	Not Available	2306	Open in IMG/M
3300009156\|Ga0111538_10249878	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	2245	Open in IMG/M
3300009156\|Ga0111538_10279394	All Organisms → cellular organisms → Bacteria	2113	Open in IMG/M
3300009156\|Ga0111538_10280837	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2108	Open in IMG/M
3300009156\|Ga0111538_10414814	All Organisms → cellular organisms → Bacteria → Proteobacteria	1705	Open in IMG/M
3300009156\|Ga0111538_10716092	Not Available	1268	Open in IMG/M
3300009156\|Ga0111538_11358189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	897	Open in IMG/M
3300009156\|Ga0111538_11530740	Not Available	841	Open in IMG/M
3300009156\|Ga0111538_11782725	Not Available	775	Open in IMG/M
3300009156\|Ga0111538_12214767	Not Available	690	Open in IMG/M
3300009156\|Ga0111538_12214767	Not Available	690	Open in IMG/M
3300009162\|Ga0075423_10010923	All Organisms → cellular organisms → Bacteria → Proteobacteria	8738	Open in IMG/M
3300009174\|Ga0105241_10946031	Not Available	803	Open in IMG/M
3300009174\|Ga0105241_11631144	Not Available	625	Open in IMG/M
3300009174\|Ga0105241_12654429	Not Available	504	Open in IMG/M
3300009792\|Ga0126374_10018708	All Organisms → cellular organisms → Bacteria → Proteobacteria	2983	Open in IMG/M
3300009792\|Ga0126374_10121900	All Organisms → cellular organisms → Bacteria	1526	Open in IMG/M
3300009792\|Ga0126374_10233731	All Organisms → cellular organisms → Bacteria	1188	Open in IMG/M
3300009792\|Ga0126374_10286987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	1095	Open in IMG/M
3300009792\|Ga0126374_10286987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	1095	Open in IMG/M
3300009792\|Ga0126374_10359510	Not Available	1002	Open in IMG/M
3300009792\|Ga0126374_10883082	Not Available	691	Open in IMG/M
3300009792\|Ga0126374_11640222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	533	Open in IMG/M
3300010043\|Ga0126380_10020413	All Organisms → cellular organisms → Bacteria → Proteobacteria	3171	Open in IMG/M
3300010043\|Ga0126380_10022341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3062	Open in IMG/M
3300010043\|Ga0126380_10063224	All Organisms → cellular organisms → Bacteria → Proteobacteria	2063	Open in IMG/M
3300010043\|Ga0126380_10173451	Not Available	1411	Open in IMG/M
3300010043\|Ga0126380_10289249	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1159	Open in IMG/M
3300010043\|Ga0126380_10478864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	949	Open in IMG/M
3300010046\|Ga0126384_10000111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	35873	Open in IMG/M
3300010046\|Ga0126384_10000556	All Organisms → cellular organisms → Bacteria → Proteobacteria	20739	Open in IMG/M
3300010046\|Ga0126384_10032455	All Organisms → cellular organisms → Bacteria → Proteobacteria	3478	Open in IMG/M
3300010046\|Ga0126384_10173836	Not Available	1680	Open in IMG/M
3300010046\|Ga0126384_12159409	Not Available	535	Open in IMG/M
3300010046\|Ga0126384_12159409	Not Available	535	Open in IMG/M
3300010047\|Ga0126382_10010303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4456	Open in IMG/M
3300010047\|Ga0126382_10010303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4456	Open in IMG/M
3300010047\|Ga0126382_10010359	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	4446	Open in IMG/M
3300010047\|Ga0126382_10011613	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4255	Open in IMG/M
3300010047\|Ga0126382_10020113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3456	Open in IMG/M
3300010047\|Ga0126382_10037828	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	2717	Open in IMG/M
3300010047\|Ga0126382_10050853	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2426	Open in IMG/M
3300010047\|Ga0126382_10051684	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2411	Open in IMG/M
3300010047\|Ga0126382_10057761	All Organisms → cellular organisms → Bacteria	2311	Open in IMG/M
3300010047\|Ga0126382_10166267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1530	Open in IMG/M
3300010047\|Ga0126382_10220047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1367	Open in IMG/M
3300010047\|Ga0126382_10250067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1298	Open in IMG/M
3300010047\|Ga0126382_10389700	Not Available	1083	Open in IMG/M
3300010047\|Ga0126382_10548330	Not Available	940	Open in IMG/M
3300010047\|Ga0126382_10548330	Not Available	940	Open in IMG/M
3300010047\|Ga0126382_10614637	Not Available	897	Open in IMG/M
3300010047\|Ga0126382_10661689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	870	Open in IMG/M
3300010047\|Ga0126382_10664920	Not Available	868	Open in IMG/M
3300010047\|Ga0126382_10745276	Not Available	828	Open in IMG/M
3300010047\|Ga0126382_11240958	Not Available	670	Open in IMG/M
3300010047\|Ga0126382_11546513	Not Available	612	Open in IMG/M
3300010047\|Ga0126382_12036169	Not Available	547	Open in IMG/M
3300010047\|Ga0126382_12055466	Not Available	545	Open in IMG/M
3300010047\|Ga0126382_12198198	Not Available	531	Open in IMG/M
3300010358\|Ga0126370_11324388	Not Available	676	Open in IMG/M
3300010358\|Ga0126370_11324388	Not Available	676	Open in IMG/M
3300010358\|Ga0126370_12131874	Not Available	551	Open in IMG/M
3300010359\|Ga0126376_10007603	All Organisms → cellular organisms → Bacteria → Proteobacteria	6609	Open in IMG/M
3300010360\|Ga0126372_10186975	All Organisms → cellular organisms → Bacteria → Proteobacteria	1707	Open in IMG/M
3300010360\|Ga0126372_10316768	All Organisms → cellular organisms → Bacteria	1380	Open in IMG/M
3300010360\|Ga0126372_10467203	Not Available	1175	Open in IMG/M
3300010360\|Ga0126372_10849458	Not Available	910	Open in IMG/M
3300010360\|Ga0126372_12234301	Not Available	596	Open in IMG/M
3300010360\|Ga0126372_12433996	Not Available	574	Open in IMG/M
3300010362\|Ga0126377_10002252	All Organisms → cellular organisms → Bacteria → Proteobacteria	13186	Open in IMG/M
3300010362\|Ga0126377_10007651	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8228	Open in IMG/M
3300010362\|Ga0126377_10007651	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8228	Open in IMG/M
3300010362\|Ga0126377_10009901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7380	Open in IMG/M
3300010362\|Ga0126377_10020059	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5480	Open in IMG/M
3300010362\|Ga0126377_10030460	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4555	Open in IMG/M
3300010362\|Ga0126377_10089699	All Organisms → cellular organisms → Bacteria	2780	Open in IMG/M
3300010362\|Ga0126377_10110064	All Organisms → cellular organisms → Bacteria	2528	Open in IMG/M
3300010362\|Ga0126377_10267542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	1672	Open in IMG/M
3300010362\|Ga0126377_10350842	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1472	Open in IMG/M
3300010362\|Ga0126377_10366068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1443	Open in IMG/M
3300010362\|Ga0126377_10541466	Not Available	1202	Open in IMG/M
3300010362\|Ga0126377_10646597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1106	Open in IMG/M
3300010362\|Ga0126377_10656382	Not Available	1098	Open in IMG/M
3300010362\|Ga0126377_10698962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1067	Open in IMG/M
3300010362\|Ga0126377_10994535	Not Available	905	Open in IMG/M
3300010362\|Ga0126377_10994535	Not Available	905	Open in IMG/M
3300010362\|Ga0126377_11092182	Not Available	866	Open in IMG/M
3300010362\|Ga0126377_11192045	Not Available	832	Open in IMG/M
3300010362\|Ga0126377_11958511	Not Available	662	Open in IMG/M
3300010362\|Ga0126377_11997751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	656	Open in IMG/M
3300010362\|Ga0126377_12008711	All Organisms → cellular organisms → Bacteria	654	Open in IMG/M
3300010362\|Ga0126377_12759083	Not Available	566	Open in IMG/M
3300010362\|Ga0126377_12966890	Not Available	547	Open in IMG/M
3300010362\|Ga0126377_13104414	Not Available	536	Open in IMG/M
3300010362\|Ga0126377_13275924	Not Available	523	Open in IMG/M
3300010362\|Ga0126377_13452873	Not Available	511	Open in IMG/M
3300010366\|Ga0126379_11442188	Not Available	794	Open in IMG/M
3300010366\|Ga0126379_11442188	Not Available	794	Open in IMG/M
3300010366\|Ga0126379_11442188	Not Available	794	Open in IMG/M
3300010371\|Ga0134125_10836405	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1012	Open in IMG/M
3300010371\|Ga0134125_12662582	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	544	Open in IMG/M
3300010396\|Ga0134126_10892780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1000	Open in IMG/M
3300010396\|Ga0134126_11221557	Not Available	835	Open in IMG/M
3300010399\|Ga0134127_13460916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	517	Open in IMG/M
3300010400\|Ga0134122_10003024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	12410	Open in IMG/M
3300010400\|Ga0134122_10003024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	12410	Open in IMG/M
3300010400\|Ga0134122_11163555	Not Available	769	Open in IMG/M
3300010400\|Ga0134122_13356903	Not Available	504	Open in IMG/M
3300010403\|Ga0134123_13302725	Not Available	520	Open in IMG/M
3300010403\|Ga0134123_13383546	Not Available	515	Open in IMG/M
3300012483\|Ga0157337_1005959	All Organisms → cellular organisms → Bacteria	830	Open in IMG/M
3300012486\|Ga0157331_1038021	Not Available	509	Open in IMG/M
3300012492\|Ga0157335_1023070	Not Available	605	Open in IMG/M
3300012493\|Ga0157355_1042555	Not Available	514	Open in IMG/M
3300012503\|Ga0157313_1060880	Not Available	516	Open in IMG/M
3300012513\|Ga0157326_1067064	Not Available	561	Open in IMG/M
3300012948\|Ga0126375_10005019	All Organisms → cellular organisms → Bacteria → Proteobacteria	5007	Open in IMG/M
3300012948\|Ga0126375_10005019	All Organisms → cellular organisms → Bacteria → Proteobacteria	5007	Open in IMG/M
3300012948\|Ga0126375_10072015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1942	Open in IMG/M
3300012948\|Ga0126375_10105142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1682	Open in IMG/M
3300012948\|Ga0126375_10139813	All Organisms → cellular organisms → Bacteria → Proteobacteria	1509	Open in IMG/M
3300012948\|Ga0126375_10179584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1368	Open in IMG/M
3300012948\|Ga0126375_10216250	Not Available	1271	Open in IMG/M
3300012948\|Ga0126375_10216250	Not Available	1271	Open in IMG/M
3300012948\|Ga0126375_10405512	All Organisms → cellular organisms → Bacteria	987	Open in IMG/M
3300012948\|Ga0126375_10478583	Not Available	922	Open in IMG/M
3300012948\|Ga0126375_10852667	All Organisms → cellular organisms → Bacteria → Proteobacteria	727	Open in IMG/M
3300012948\|Ga0126375_11020426	Not Available	675	Open in IMG/M
3300012948\|Ga0126375_11231397	Not Available	625	Open in IMG/M
3300012948\|Ga0126375_11387083	Not Available	595	Open in IMG/M
3300012948\|Ga0126375_11983518	Not Available	514	Open in IMG/M
3300012957\|Ga0164303_10982050	Not Available	599	Open in IMG/M
3300012960\|Ga0164301_10826740	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	711	Open in IMG/M
3300012971\|Ga0126369_10893143	Not Available	974	Open in IMG/M
3300012986\|Ga0164304_10323855	Not Available	1066	Open in IMG/M
3300015371\|Ga0132258_10001529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	40869	Open in IMG/M
3300015371\|Ga0132258_10003035	All Organisms → cellular organisms → Bacteria → Proteobacteria	31627	Open in IMG/M
3300015371\|Ga0132258_10003618	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	29552	Open in IMG/M
3300015371\|Ga0132258_10003618	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	29552	Open in IMG/M
3300015371\|Ga0132258_10005976	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	24058	Open in IMG/M
3300015371\|Ga0132258_10010513	All Organisms → cellular organisms → Bacteria	19218	Open in IMG/M
3300015371\|Ga0132258_10013649	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	17226	Open in IMG/M
3300015371\|Ga0132258_10024931	All Organisms → cellular organisms → Bacteria → Proteobacteria	13184	Open in IMG/M
3300015371\|Ga0132258_10078625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	7684	Open in IMG/M
3300015371\|Ga0132258_10136080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5868	Open in IMG/M
3300015371\|Ga0132258_10324219	Not Available	3799	Open in IMG/M
3300015371\|Ga0132258_10337780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3720	Open in IMG/M
3300015371\|Ga0132258_11357151	All Organisms → cellular organisms → Bacteria	1796	Open in IMG/M
3300015371\|Ga0132258_11357151	All Organisms → cellular organisms → Bacteria	1796	Open in IMG/M
3300015371\|Ga0132258_11376453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1783	Open in IMG/M
3300015371\|Ga0132258_11657097	All Organisms → cellular organisms → Bacteria → Proteobacteria	1614	Open in IMG/M
3300015371\|Ga0132258_12215871	Not Available	1379	Open in IMG/M
3300015371\|Ga0132258_12300138	All Organisms → cellular organisms → Bacteria	1352	Open in IMG/M
3300015371\|Ga0132258_12300138	All Organisms → cellular organisms → Bacteria	1352	Open in IMG/M
3300015371\|Ga0132258_12581425	All Organisms → cellular organisms → Bacteria	1270	Open in IMG/M
3300015372\|Ga0132256_101180305	All Organisms → cellular organisms → Bacteria	879	Open in IMG/M
3300015372\|Ga0132256_102123338	Not Available	667	Open in IMG/M
3300015372\|Ga0132256_102418055	Not Available	628	Open in IMG/M
3300015373\|Ga0132257_100836547	Not Available	1151	Open in IMG/M
3300015373\|Ga0132257_101063102	Not Available	1020	Open in IMG/M
3300015373\|Ga0132257_101588306	Not Available	836	Open in IMG/M
3300015374\|Ga0132255_100081555	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4334	Open in IMG/M
3300015374\|Ga0132255_100452995	All Organisms → cellular organisms → Bacteria → Proteobacteria	1878	Open in IMG/M
3300015374\|Ga0132255_100722043	All Organisms → cellular organisms → Bacteria	1481	Open in IMG/M
3300015374\|Ga0132255_101876368	Not Available	911	Open in IMG/M
3300015374\|Ga0132255_105848193	Not Available	520	Open in IMG/M
3300017792\|Ga0163161_10461304	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1028	Open in IMG/M
3300017970\|Ga0187783_10351324	Not Available	1073	Open in IMG/M
3300017970\|Ga0187783_10439469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1	947	Open in IMG/M
3300018078\|Ga0184612_10146787	Not Available	1233	Open in IMG/M
3300018081\|Ga0184625_10226898	Not Available	979	Open in IMG/M
3300018429\|Ga0190272_12083211	All Organisms → cellular organisms → Bacteria	604	Open in IMG/M
3300018429\|Ga0190272_12083211	All Organisms → cellular organisms → Bacteria	604	Open in IMG/M
3300018469\|Ga0190270_11560614	Not Available	711	Open in IMG/M
3300018476\|Ga0190274_12943817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	571	Open in IMG/M
3300019212\|Ga0180106_1159132	Not Available	635	Open in IMG/M
3300019233\|Ga0184645_1133644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	640	Open in IMG/M
3300019233\|Ga0184645_1232531	Not Available	544	Open in IMG/M
3300019233\|Ga0184645_1232531	Not Available	544	Open in IMG/M
3300019377\|Ga0190264_10705387	Not Available	746	Open in IMG/M
3300022531\|Ga0242660_1248166	Not Available	507	Open in IMG/M
3300022533\|Ga0242662_10167837	Not Available	674	Open in IMG/M
3300025911\|Ga0207654_10502777	Not Available	856	Open in IMG/M
3300025916\|Ga0207663_10242305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1323	Open in IMG/M
3300025932\|Ga0207690_11273071	All Organisms → cellular organisms → Bacteria → Proteobacteria	614	Open in IMG/M
3300025933\|Ga0207706_10893453	Not Available	751	Open in IMG/M
3300025935\|Ga0207709_11282493	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M
3300025939\|Ga0207665_10553397	Not Available	894	Open in IMG/M
3300025972\|Ga0207668_10629713	All Organisms → cellular organisms → Bacteria	937	Open in IMG/M
3300025972\|Ga0207668_10629713	All Organisms → cellular organisms → Bacteria	937	Open in IMG/M
3300025972\|Ga0207668_11158027	Not Available	694	Open in IMG/M
3300025972\|Ga0207668_11158027	Not Available	694	Open in IMG/M
3300025972\|Ga0207668_12075301	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. OV329	512	Open in IMG/M
3300026067\|Ga0207678_10143252	Not Available	2040	Open in IMG/M
3300026067\|Ga0207678_10272963	All Organisms → cellular organisms → Bacteria → Proteobacteria	1450	Open in IMG/M
3300026067\|Ga0207678_10344366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1285	Open in IMG/M
3300026067\|Ga0207678_10345284	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1283	Open in IMG/M
3300026067\|Ga0207678_11198076	Not Available	672	Open in IMG/M
3300026067\|Ga0207678_11797248	Not Available	537	Open in IMG/M
3300026075\|Ga0207708_10011940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	6470	Open in IMG/M
3300026075\|Ga0207708_10027541	All Organisms → cellular organisms → Bacteria	4303	Open in IMG/M
3300026075\|Ga0207708_10237481	All Organisms → cellular organisms → Bacteria	1465	Open in IMG/M
3300026118\|Ga0207675_100569646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	1133	Open in IMG/M
3300027646\|Ga0209466_1096641	Not Available	598	Open in IMG/M
3300027646\|Ga0209466_1096641	Not Available	598	Open in IMG/M
3300027646\|Ga0209466_1108385	Not Available	564	Open in IMG/M
3300027775\|Ga0209177_10022328	All Organisms → cellular organisms → Bacteria	1577	Open in IMG/M
3300027775\|Ga0209177_10022328	All Organisms → cellular organisms → Bacteria	1577	Open in IMG/M
3300027775\|Ga0209177_10036270	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. KLBC 81	1325	Open in IMG/M
3300027787\|Ga0209074_10142989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	853	Open in IMG/M
3300027787\|Ga0209074_10299477	All Organisms → cellular organisms → Bacteria → Terrabacteria group	642	Open in IMG/M
3300027787\|Ga0209074_10305578	Not Available	637	Open in IMG/M
3300027787\|Ga0209074_10426201	Not Available	561	Open in IMG/M
3300027873\|Ga0209814_10136625	Not Available	1049	Open in IMG/M
3300027873\|Ga0209814_10348922	Not Available	647	Open in IMG/M
3300027907\|Ga0207428_10014697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	6786	Open in IMG/M
3300027907\|Ga0207428_10015084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6691	Open in IMG/M
3300027907\|Ga0207428_10021995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5387	Open in IMG/M
3300027907\|Ga0207428_10021995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5387	Open in IMG/M
3300027907\|Ga0207428_10021995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5387	Open in IMG/M
3300027907\|Ga0207428_10025405	All Organisms → cellular organisms → Bacteria	4959	Open in IMG/M
3300027907\|Ga0207428_10141871	All Organisms → cellular organisms → Bacteria	1833	Open in IMG/M
3300027907\|Ga0207428_10143549	All Organisms → cellular organisms → Bacteria	1821	Open in IMG/M
3300027907\|Ga0207428_10176119	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1618	Open in IMG/M
3300027907\|Ga0207428_10192160	Not Available	1538	Open in IMG/M
3300027907\|Ga0207428_10310462	Not Available	1166	Open in IMG/M
3300027907\|Ga0207428_10414226	All Organisms → cellular organisms → Bacteria	986	Open in IMG/M
3300027907\|Ga0207428_10431992	All Organisms → cellular organisms → Bacteria → Proteobacteria	962	Open in IMG/M
3300027907\|Ga0207428_10457138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	930	Open in IMG/M
3300027907\|Ga0207428_10569311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	818	Open in IMG/M
3300027907\|Ga0207428_10611891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	784	Open in IMG/M
3300027907\|Ga0207428_10705517	All Organisms → cellular organisms → Bacteria → Proteobacteria	721	Open in IMG/M
3300027907\|Ga0207428_10793139	Not Available	673	Open in IMG/M
3300027907\|Ga0207428_11233343	Not Available	520	Open in IMG/M
3300027909\|Ga0209382_10224147	Not Available	2144	Open in IMG/M
3300027911\|Ga0209698_11081826	Not Available	595	Open in IMG/M
3300028381\|Ga0268264_12421482	Not Available	531	Open in IMG/M
3300028381\|Ga0268264_12618356	Not Available	509	Open in IMG/M
3300028381\|Ga0268264_12618356	Not Available	509	Open in IMG/M
3300031184\|Ga0307499_10031838	Not Available	1203	Open in IMG/M
3300031184\|Ga0307499_10066259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	922	Open in IMG/M
3300031184\|Ga0307499_10066259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	922	Open in IMG/M
3300031184\|Ga0307499_10078460	Not Available	866	Open in IMG/M
3300031184\|Ga0307499_10195213	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300031198\|Ga0307500_10207995	Not Available	587	Open in IMG/M
3300031198\|Ga0307500_10250979	Not Available	546	Open in IMG/M
3300031198\|Ga0307500_10277776	Not Available	525	Open in IMG/M
3300031562\|Ga0310886_10233814	Not Available	1020	Open in IMG/M
3300031576\|Ga0247727_10000777	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	77942	Open in IMG/M
3300031576\|Ga0247727_10000777	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	77942	Open in IMG/M
3300031576\|Ga0247727_10000777	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	77942	Open in IMG/M
3300031677\|Ga0307480_1008049	Not Available	698	Open in IMG/M
3300031677\|Ga0307480_1008049	Not Available	698	Open in IMG/M
3300031677\|Ga0307480_1008959	Not Available	675	Open in IMG/M
3300031677\|Ga0307480_1008959	Not Available	675	Open in IMG/M
3300031677\|Ga0307480_1008959	Not Available	675	Open in IMG/M
3300031677\|Ga0307480_1024266	Not Available	504	Open in IMG/M
3300031677\|Ga0307480_1024266	Not Available	504	Open in IMG/M
3300031720\|Ga0307469_10068843	All Organisms → cellular organisms → Bacteria	2334	Open in IMG/M
3300031720\|Ga0307469_10391477	Not Available	1183	Open in IMG/M
3300031720\|Ga0307469_10594822	All Organisms → cellular organisms → Bacteria	988	Open in IMG/M
3300031720\|Ga0307469_10660857	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	943	Open in IMG/M
3300031720\|Ga0307469_10797750	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	866	Open in IMG/M
3300031720\|Ga0307469_11335422	Not Available	682	Open in IMG/M
3300031720\|Ga0307469_11957154	Not Available	568	Open in IMG/M
3300031740\|Ga0307468_100009859	All Organisms → cellular organisms → Bacteria → Proteobacteria	3670	Open in IMG/M
3300031740\|Ga0307468_100042499	Not Available	2295	Open in IMG/M
3300031740\|Ga0307468_100046460	All Organisms → cellular organisms → Bacteria	2228	Open in IMG/M
3300031740\|Ga0307468_100254956	All Organisms → cellular organisms → Bacteria	1237	Open in IMG/M
3300031740\|Ga0307468_100254956	All Organisms → cellular organisms → Bacteria	1237	Open in IMG/M
3300031740\|Ga0307468_100262292	Not Available	1224	Open in IMG/M
3300031820\|Ga0307473_10588168	All Organisms → cellular organisms → Bacteria	766	Open in IMG/M
3300031908\|Ga0310900_10226762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1331	Open in IMG/M
3300031908\|Ga0310900_10466380	Not Available	974	Open in IMG/M
3300031908\|Ga0310900_10512489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	934	Open in IMG/M
3300031908\|Ga0310900_11212679	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300031908\|Ga0310900_11534090	Not Available	562	Open in IMG/M
3300031949\|Ga0214473_12210029	Not Available	530	Open in IMG/M
3300032012\|Ga0310902_10834678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	630	Open in IMG/M
3300032174\|Ga0307470_10033314	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	2477	Open in IMG/M
3300032174\|Ga0307470_10158716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1394	Open in IMG/M
3300032174\|Ga0307470_10204140	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1266	Open in IMG/M
3300032174\|Ga0307470_10725906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	760	Open in IMG/M
3300032174\|Ga0307470_10907935	Not Available	692	Open in IMG/M
3300032174\|Ga0307470_10926227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	687	Open in IMG/M
3300032179\|Ga0310889_10657958	Not Available	544	Open in IMG/M
3300032180\|Ga0307471_100139554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2306	Open in IMG/M
3300032180\|Ga0307471_100435672	All Organisms → cellular organisms → Bacteria	1447	Open in IMG/M
3300032180\|Ga0307471_100435672	All Organisms → cellular organisms → Bacteria	1447	Open in IMG/M
3300032180\|Ga0307471_100912321	Not Available	1046	Open in IMG/M
3300032205\|Ga0307472_100454908	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	1089	Open in IMG/M
3300032205\|Ga0307472_100913175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	814	Open in IMG/M
3300032205\|Ga0307472_101542524	Not Available	650	Open in IMG/M
3300034660\|Ga0314781_078459	Not Available	635	Open in IMG/M
3300034661\|Ga0314782_161934	Not Available	556	Open in IMG/M
3300034661\|Ga0314782_161934	Not Available	556	Open in IMG/M
3300034669\|Ga0314794_082409	Not Available	663	Open in IMG/M
3300034670\|Ga0314795_063650	Not Available	678	Open in IMG/M
3300034670\|Ga0314795_126782	Not Available	535	Open in IMG/M
3300034670\|Ga0314795_126782	Not Available	535	Open in IMG/M
3300034671\|Ga0314796_172417	Not Available	519	Open in IMG/M
3300034672\|Ga0314797_132480	Not Available	539	Open in IMG/M
3300034817\|Ga0373948_0031554	Not Available	1071	Open in IMG/M
3300034817\|Ga0373948_0151482	Not Available	580	Open in IMG/M
3300034818\|Ga0373950_0025762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1064	Open in IMG/M
3300034818\|Ga0373950_0117692	Not Available	585	Open in IMG/M
3300034819\|Ga0373958_0150531	Not Available	582	Open in IMG/M
3300034819\|Ga0373958_0197503	Not Available	525	Open in IMG/M
3300034820\|Ga0373959_0142653	Not Available	601	Open in IMG/M

Habitat	Taxonomy	Distribution
Environmental	Environmental	64.85%
Host-Associated	Host-Associated	35.15%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	62.92%
Plants	Host-Associated → Plants	35.15%
Aquatic	Environmental → Aquatic	1.93%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	62.21%
Rhizosphere	Host-Associated → Plants → Rhizosphere	23.20%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.95%
Freshwater	Environmental → Aquatic → Freshwater	1.41%
Sediment	Environmental → Aquatic → Sediment	0.53%
Cave	Environmental → Terrestrial → Cave	0.70%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	39.02%
Loam	Environmental → Terrestrial → Soil → Loam	22.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	18.98%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.03%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.92%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.22%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.41%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.53%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.53%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.70%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.37%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	19.51%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	18.98%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.03%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.85%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.22%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.51%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.99%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.28%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.58%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.41%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.88%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.53%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	0.53%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.53%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.18%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.70%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	19.51%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	17.93%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	17.75%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	6.15%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.92%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	3.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.51%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.99%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.99%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.28%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.11%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.58%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.58%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	1.23%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.53%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.53%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	0.53%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.35%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.35%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.35%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.18%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.18%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.18%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.18%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.18%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.18%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.70%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.70%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.70%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.70%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.70%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000787	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000858	Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300003725	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004268	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio	Environmental	Open in IMG/M
3300004281	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006937	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012483	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610	Host-Associated	Open in IMG/M
3300012486	Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510	Environmental	Open in IMG/M
3300012492	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610	Host-Associated	Open in IMG/M
3300012493	Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610	Environmental	Open in IMG/M
3300012503	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R	Host-Associated	Open in IMG/M
3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Host-Associated	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300019212	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019233	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300022531	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022533	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031184	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S	Environmental	Open in IMG/M
3300031198	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031576	Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25	Environmental	Open in IMG/M
3300031677	Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032012	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032179	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033803	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10	Environmental	Open in IMG/M
3300034660	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034661	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034669	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034670	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034671	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034672	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated	Open in IMG/M
3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Host-Associated	Open in IMG/M
3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Host-Associated	Open in IMG/M
3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiFebDRAFT_132624002	3300000363	Soil	MQTITSALVALLLVAGVAGAAQALDAKTFYEEVDRNHN*
INPhiseqgaiiFebDRAFT_1003435751	3300000364	Soil	MKTILSALVALSVIASVAVPANALDAKTFFEQVDRDHN*
F24TB_100703053	3300000550	Soil	MKTITSALVALLMIAGVTGTANAFDARTFYEQIDRDHN*
F24TB_118179001	3300000550	Soil	MQTITSALVALLLLTGIASSAQALDARSFYEQVDRNHN*
JGI11643J11755_106935382	3300000787	Soil	MQTITSAFVALLVIAGAVGTAKAFDAKIFYEQVDRNRN*
JGI10213J12805_100066122	3300000858	Soil	MKTVLSALVAFSLIAGIAGTASALDAKAFYEQVDRTHN*
JGI10213J12805_100066123	3300000858	Soil	MKTILSALIALSVIAGIAQTASAFDAKTFYEQVDRDHN*
JGI10213J12805_102226832	3300000858	Soil	MQTILSALVALLVIASVAGVAHALDAKSFYEEIDRTHY*
JGI10213J12805_107829743	3300000858	Soil	MKTILSALVALSVIAGVAGTASAFDAKDFYEQVDRNHN*
JGI10213J12805_107829744	3300000858	Soil	MKTILSALVALSVIVGVASGAVAIDTKEFYERVDRNHF*
JGI10213J12805_115584941	3300000858	Soil	LGILRGEIAMKTILSALIALSVIAGVASTASAMDTREFYERVDRNHF*
F14TB_1011528061	3300001431	Soil	SALFALSVLAGFAGTAAANVDAKTFYEQVDRDRF*
F14TB_1014664942	3300001431	Soil	MKTITSALVALLMIAGVTGTANAFDARTFXXXXDRDHN*
F14TB_1017582722	3300001431	Soil	MKTILSALVALSVIASVAGTASALDAKTFFEQVDRDHN*
JGI25404J52841_101019051	3300003659	Tabebuia Heterophylla Rhizosphere	MIMKTILSALVALSVIAGVAGSASAFDAKSFYEQIDRNHN*
Ga0008087_1083602	3300003725	Tropical Rainforest Soil	LIMKTILSALVALSVIAGVAGTASAFDAKSFYEQVDRNHN*
Ga0008087_1083603	3300003725	Tropical Rainforest Soil	LIMKTILSALVALSVIAGVAGTASALDAKTFYEQVDRDHN*
Ga0066398_101963911	3300004268	Tropical Forest Soil	TVNQPLKRRMIMKLIMSALVALSVITGVAGSANAFDTKTFFEQVDRDHN*
Ga0066397_100082232	3300004281	Tropical Forest Soil	MIMKLIMSALVALSVIAGVAGSANAFDTKTFFEQVDRDHN*
Ga0066397_100742631	3300004281	Tropical Forest Soil	MKTILSAIVALSVIAGVAGSASAALDAKTFFEQVDRDHN*
Ga0066397_100742632	3300004281	Tropical Forest Soil	MIMKTILSALIALSVIAGVAGTASAMDAKEFYERVDRNHF*
Ga0062595_1000339863	3300004479	Soil	MQTITSAAVIALMLLTGIAGAAQALDAKSFYEQVDRNHN*
Ga0062595_1000451644	3300004479	Soil	MIMKTIVSALIALSVLAGVAGTVQAFDAKTFYDQVDRDHN*
Ga0062594_1005916113	3300005093	Soil	MIMKIILSALVALSVIASVAGSASALDAKTFFEQIDRDHN*
Ga0066388_1000370176	3300005332	Tropical Forest Soil	MIMKTILSALVALSVIAGVAGTASALDAKTFWEQIDRDHN*
Ga0066388_1000577161	3300005332	Tropical Forest Soil	MIMKTILSALVALSVIAGVAGSASALDAKTFYEQVDRNHY*
Ga0066388_1004624564	3300005332	Tropical Forest Soil	LNRRRETMKSILSALVALSVIAGVAGSASAFDAKTFYEQIDRNGN*
Ga0066388_1007377082	3300005332	Tropical Forest Soil	MKTITSAVVGALVALLAIAGVAGMAQAFDTKAFYEQVDRNHN*
Ga0066388_1010177112	3300005332	Tropical Forest Soil	NRGKISMKTILSALVALSVIAGIAGTASAFDTKTFYEQIDRDHN*
Ga0066388_1025666722	3300005332	Tropical Forest Soil	MIMKTILSALVALSVIAGVAGSASALDAKTFFEQVDRDHN*
Ga0066388_1036977232	3300005332	Tropical Forest Soil	LGALRGEIAMKIILSALLALSVIAGVAGSASAMDAKEFYERVDRNHF*
Ga0066388_1038676292	3300005332	Tropical Forest Soil	MIMKIILSALIALSVIAGGAASASALDAKTFFEQVDRDHN*
Ga0066388_1058185842	3300005332	Tropical Forest Soil	MSTILSALVALSVIAGVAGTANAFDAKSFYEQVDRNHN*PVTMPRP
Ga0066388_1067643922	3300005332	Tropical Forest Soil	MIMKLIMSALVVLSVIAGVAGSANAFDTKTFFEQVDRDHN*
Ga0068869_1012236322	3300005334	Miscanthus Rhizosphere	QLSKRRMIMKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0070663_1003023833	3300005455	Corn Rhizosphere	MKTILSALIALSVLAGFAGNAAANVDAKSFYEQVDRDRF*
Ga0070697_1005259621	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	QTVNRPHQRRMIMKIILSALVALSVIASVAGSASALDAKTFFEQIDRDHN*
Ga0070695_1000113115	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	MIMKTILSALVALSVIASVAGTANALDAKSFFEQVDRDHN*
Ga0070704_1007414401	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	EELAMKTITSALAALLVIAAVAGTAQAFDAKTFYEQVDRNHN*
Ga0066905_1000008365	3300005713	Tropical Forest Soil	MKTITSALVALLLIAGVAGTAQAYDAKAFFEQVDRNHN*
Ga0066905_1000034353	3300005713	Tropical Forest Soil	MQTITSALVALLVIAGVAGAAQAFDAKTFYEQIDRNHN*
Ga0066905_1000077403	3300005713	Tropical Forest Soil	MKTITSALVALVLLTGITGSAHALDAKRFYEQVDRKHN*
Ga0066905_1000105996	3300005713	Tropical Forest Soil	MKTILSVLIALSVIASVAGTASAMDAKEFYERVDRSHF*
Ga0066905_1000105997	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASALDAKAFFEQIDRDHN*
Ga0066905_1000111524	3300005713	Tropical Forest Soil	MKTIVSALIALSVLAGFAGTAAANVDAKTFYEQVDRDRF*
Ga0066905_1000220496	3300005713	Tropical Forest Soil	MKLIMSALVALSVIAGVAGSANAFDTKTFFEQVDRDHN*
Ga0066905_1000220497	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASAMDAKEFYEQVDRNHF*
Ga0066905_1000329082	3300005713	Tropical Forest Soil	MKTITSAVVALLVIAGVAGAAQAFDAKSFYEQVDRNHN*
Ga0066905_1000353612	3300005713	Tropical Forest Soil	MKTILSALIALAVIAGVAGTASALDTKAFFEQIDRDHN*
Ga0066905_1000482141	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGTASALDAKTFWEQVDRNHN*
Ga0066905_1000482142	3300005713	Tropical Forest Soil	MKTILSVLVALSVIAGVAGAASAMDTKEFYERVDRNHF*
Ga0066905_1000656154	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGFAGTTSAFDTKIFYEQIDRDHN*
Ga0066905_1000663015	3300005713	Tropical Forest Soil	GEIAMKTILSALVALSVIASSASALDAKTFFEQVDRDHN*
Ga0066905_1000723631	3300005713	Tropical Forest Soil	MKTILSALLALSVIAGVAGTASAMDAKEFYERVDRNHF*
Ga0066905_1000848474	3300005713	Tropical Forest Soil	MKTILSALVALSVIASAAGPANALDAKTFFEQVDRDHN*
Ga0066905_1000984883	3300005713	Tropical Forest Soil	MKTITSALIALLVIAGAAGTANAFDATIFYEQVDRNRN*
Ga0066905_1000992822	3300005713	Tropical Forest Soil	MQTITSALVALMLITGIAGAAQALDAKSFYERVDRNHN*
Ga0066905_1001006212	3300005713	Tropical Forest Soil	MKTILSALIALSVLAGFAGTAAANVDTKAFYEQVDRDRF*
Ga0066905_1001043743	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGSARALDAKTFFEQVDRDHN*
Ga0066905_1001123822	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASALDAKSFYEQVDRNHY*
Ga0066905_1001216171	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASAFDAKDFYEQLDRNHN*
Ga0066905_1001338292	3300005713	Tropical Forest Soil	MKTILSALLALSVIAGVAGSASALDAKTFYEQVDRDHN*
Ga0066905_1001338983	3300005713	Tropical Forest Soil	MKTILSALVALSVVTGVAGTANALDAKTFWEQIDRDHN*
Ga0066905_1001338984	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASAMDAKEFYERVDRNHF*
Ga0066905_1001353612	3300005713	Tropical Forest Soil	MKTILSALIALSVIAGVAGTASAMDTKEFYERVDRNHF*
Ga0066905_1001411232	3300005713	Tropical Forest Soil	MKTILSALIALSVIVGVAGSASAFDAKEFYERVDRNHN*
Ga0066905_1001688932	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASAFDTKTFFEQVDRDHN*
Ga0066905_1001740232	3300005713	Tropical Forest Soil	MKTILSALVALSLIAGVAGSASAMDAKTFYEQVDRNHY*
Ga0066905_1002121883	3300005713	Tropical Forest Soil	KTILSALVALAVIAGVAGTANAAIDAKTFFEQVDRDHN*
Ga0066905_1002134551	3300005713	Tropical Forest Soil	MKTILTALVALSVIASVAGTASAFDAKDFYAQVDRNHN*
Ga0066905_1002304592	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGIAGTASAFDTKTFYEQIDRDHN*
Ga0066905_1002397523	3300005713	Tropical Forest Soil	MKTILSALVALSLIAGVAASASAFDPKAFFDQVDREHN*
Ga0066905_1002397524	3300005713	Tropical Forest Soil	MKTILSALLALSVIAGVAGSASALDAKSFYEQVDRDHN*
Ga0066905_1002397525	3300005713	Tropical Forest Soil	MKTILSALVALSLIAGVAGSASALDAKSFYEQVDRDHN*
Ga0066905_1002965724	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVVGGASAMDAKEFYERVDRNHF*
Ga0066905_1002965725	3300005713	Tropical Forest Soil	MKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0066905_1003208792	3300005713	Tropical Forest Soil	MKTITSALVALLVIAGVAGAAQAFDTKTFYEQLDRDHN*
Ga0066905_1003437392	3300005713	Tropical Forest Soil	MKTITSALAALLLIAGVAGSANAFDAKTFYEQVDRDRN*
Ga0066905_1003466021	3300005713	Tropical Forest Soil	MKTILSTLVALSVIAGVASTASAFDAKSFYEQIDRDHN*
Ga0066905_1003667801	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGTASAFDAKSFYEQVDRDHN*
Ga0066905_1003667802	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGTASAFDAKSFYEQVDRNHN*
Ga0066905_1003667803	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGTASALDAKTFYEQVDRDHN*
Ga0066905_1004121202	3300005713	Tropical Forest Soil	MKTITSALVALLVIAGGVATAQAFDAKSFYERLDRTNN*
Ga0066905_1004517902	3300005713	Tropical Forest Soil	MKTILSALVALSVIASVAGQANALDAKTFFEQVDRDHN*
Ga0066905_1004700303	3300005713	Tropical Forest Soil	MKTITSALVALLLVAGVAGSAQAFDAKDFYEQVDRNHN*
Ga0066905_1005011182	3300005713	Tropical Forest Soil	IMKTILSALVALSVIAGVAGSASALDAKTFFEQIDRDHN*
Ga0066905_1005128132	3300005713	Tropical Forest Soil	MKTILSALVVLSVIAGVAGSASALDAKTFFEQIDRDHN*
Ga0066905_1005929812	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVVGSASALDAKTFYEQVDRSHY*
Ga0066905_1005929813	3300005713	Tropical Forest Soil	MKTILSALIALSVIAGVAGSASALDAKSFYEQVDRNHY*
Ga0066905_1005978262	3300005713	Tropical Forest Soil	MKTIQCALVALSLFAGVAGSANAFDAKAFYEQVDRDHN*
Ga0066905_1006035532	3300005713	Tropical Forest Soil	MKTITSALVALLLIAGLASAATALDAKSFYEQVDRNHY*
Ga0066905_1006035533	3300005713	Tropical Forest Soil	MKTILSALLALSVIAGVAGAASAFDAKTFFEQVDRDHN*
Ga0066905_1006319881	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVTGTASAFDAKDFYEQVDRNHN*
Ga0066905_1006617052	3300005713	Tropical Forest Soil	MKSITSALVALLVIAGVAGAAQAFDAKTFYEQVDRNHN*
Ga0066905_1007759051	3300005713	Tropical Forest Soil	MKTILSALIALSVIASVAGQANALDAKTFFEQVDRDHN*
Ga0066905_1010089632	3300005713	Tropical Forest Soil	MKTILSALVVLSVIASVAGTASAFDAKDFYEQVDRNHN*
Ga0066905_1011233962	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASAALDAKTFFEQVDRDHN*
Ga0066905_1017085762	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASALDAKSFYEQVDRDHY*
Ga0066905_1017085763	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASALDAKTFYEQVDRDHN*
Ga0066905_1018154992	3300005713	Tropical Forest Soil	MKTIVSALVALSVIAGVASAAAAFDAKDFYEQVDRNHN*
Ga0066905_1018558682	3300005713	Tropical Forest Soil	MKTITSALVALLLIVGVGGAANAFDSKVFYEQMDRDRN*
Ga0066905_1018739272	3300005713	Tropical Forest Soil	KTILSALIALSVIASVAGQANALDAKTFFEQVDRDHN*
Ga0066905_1020833391	3300005713	Tropical Forest Soil	MKTILSTLVALSVIAGVASAASAFDTKTFYEQLDREHN*
Ga0066905_1021971001	3300005713	Tropical Forest Soil	MKTITSALVALLVIAGAAGTANALDAKIFYEQVDRNRN*
Ga0066905_1022170412	3300005713	Tropical Forest Soil	MIMKTILSALVALSVIAGVAGSASALDAKTFFEQIDRDHN*
Ga0066905_1022170413	3300005713	Tropical Forest Soil	KTILSALLALSVIAGVAGSASAMDAKEFYERVDRNHF*
Ga0066905_1023038252	3300005713	Tropical Forest Soil	MKTILSALVGLSVIAGVAGSASALDAKTFYEQVDRDHN*
Ga0066905_1023249481	3300005713	Tropical Forest Soil	MKTILSALIALSVIAGVAGSASAMDAKEFYERVDRNHF*
Ga0066905_1023249482	3300005713	Tropical Forest Soil	MKTILSALVALSVIAGVAGTANALDAKAFWERIDRDHN*
Ga0068861_1000270395	3300005719	Switchgrass Rhizosphere	MKTILSALIALSVLAGFAGSAAADVDAKTLYEQMDRDRF*
Ga0068861_1001234592	3300005719	Switchgrass Rhizosphere	MKTITSALAALLVIAAVAGTAQAFDAKTFYEQVDRNHN*
Ga0068861_1002128644	3300005719	Switchgrass Rhizosphere	MKTILSALIALSVIAGVAGSASAFDAKTFYEQVDRDHN*
Ga0068861_1014168982	3300005719	Switchgrass Rhizosphere	MKTILSALVALLVIAGVAGTASAMDAKTFYEQVDRNHY*
Ga0068861_1014168983	3300005719	Switchgrass Rhizosphere	MKIILSALVALSVIASVAGSASALDAKTFFEQIDRDHN*
Ga0068861_1021263141	3300005719	Switchgrass Rhizosphere	MITKTILSALVALSVIASVAGTANALDAKSFFEQVDRDHN*
Ga0068861_1021263142	3300005719	Switchgrass Rhizosphere	MKTILSALVALSVIAGVAGGAVAMDAKEFYERVDRNHF*
Ga0066903_1000535844	3300005764	Tropical Forest Soil	MKTILSALVALSVIAGVAGTASALDAKTFWEQIDRDHN*
Ga0066903_1000607286	3300005764	Tropical Forest Soil	MKAITSALVALLVIAGAAGTANALDAKIFYEQVDRNRN*
Ga0066903_1000658095	3300005764	Tropical Forest Soil	MKTILSALVALSVLAGITGTASAFDAKDFYEQVDRNHN*
Ga0066903_1001063054	3300005764	Tropical Forest Soil	MKTILCALVALSLFAGVAGSANAFDAKAFYEQVDRDHN*
Ga0066903_1001310419	3300005764	Tropical Forest Soil	MKTILSALIALSVIASVTGPANALDTKTFFEQIDRDHN*
Ga0066903_1002044951	3300005764	Tropical Forest Soil	MKTILSALVALSVMAGIAGSASALDAKTFFEQIDRDHN*
Ga0066903_1003010701	3300005764	Tropical Forest Soil	MKTILSALVALSLIAGVAGSASAFDAKSFYEQVDRDHN*
Ga0066903_1003010703	3300005764	Tropical Forest Soil	MKTILSALLALSVIAGVAGSASAFDPKAFFDQIDREHN*
Ga0066903_1004564472	3300005764	Tropical Forest Soil	MKTILSALLALSVIAGVAGSASAMDAKEFYERVDRNHF*
Ga0066903_1006869692	3300005764	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASALDAKTFFEQIDRDHN*
Ga0066903_1008637033	3300005764	Tropical Forest Soil	MKTITSALVALLVIAGVAGAANAFDAKTFYEQVDRDRN*
Ga0066903_1011061345	3300005764	Tropical Forest Soil	MKTILSALVALSVIAGVAGTASAFDAKTFYEQIDRDHN*
Ga0066903_1011575852	3300005764	Tropical Forest Soil	MKTILSALVALSVLAGVAGSASAMDAKEFYEQVDRNHF*
Ga0066903_1011575853	3300005764	Tropical Forest Soil	MKLIMSALVALSVIAGVAGTANAFDTKTFFEQVDRDH
Ga0066903_1011873303	3300005764	Tropical Forest Soil	MIGEIAMKTILSALVALSVIAGVAGSACAFDTKTFFEQVDRDHN*
Ga0066903_1012494632	3300005764	Tropical Forest Soil	MQTILSALVALSLIAGVAGSASALDAKTFYEQVDRNHY*
Ga0066903_1012494633	3300005764	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASALDAKTFYEQVDRNHY*
Ga0066903_1012494634	3300005764	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASALDAKTFFEQVDRDHN*
Ga0066903_1027921791	3300005764	Tropical Forest Soil	MKTIPSALVALLVIAGVAGAANAFDAKTFYEQVDRDRN*
Ga0066903_1032799192	3300005764	Tropical Forest Soil	MKTILSALVALSVIAGVAGTANALDAKTFFEQVDRDHN*
Ga0066903_1035393711	3300005764	Tropical Forest Soil	MKTILSALIALSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0066903_1065653881	3300005764	Tropical Forest Soil	MKTILSALVALSVIAGVAGGASALDAKTFFEQVDRDHN*
Ga0066903_1066908131	3300005764	Tropical Forest Soil	IAMKTILSALVALSVIAGVAGSASAFDTKTFFEQVDRDHN*
Ga0066903_1075392462	3300005764	Tropical Forest Soil	GLGALGGEIPMKIILSALVALSVIAGSTIALDARTFFE*
Ga0068860_1027818672	3300005843	Switchgrass Rhizosphere	TILSALVALLVIAGVAGTASAMDAKTFYEQVDRNHY*
Ga0081455_1000005291	3300005937	Tabebuia Heterophylla Rhizosphere	MHTITSALVALMLITGIAGAAQALDAKGFYERVDRNHN*
Ga0081455_100000535	3300005937	Tabebuia Heterophylla Rhizosphere	MKTILSALIALSVIAGVAGTASAFDAKDFYERIDRNHN*
Ga0081455_1000008715	3300005937	Tabebuia Heterophylla Rhizosphere	MKTILSALVALSVIAGVAGSASALDAKTFYEQIDRDHN*
Ga0081455_1000008716	3300005937	Tabebuia Heterophylla Rhizosphere	MKTILSALVALSVIAGVAGSASALDAKTFYEQVDRSHY*
Ga0081455_1000041218	3300005937	Tabebuia Heterophylla Rhizosphere	MQTITSALVALLVIAGVAGAAQAFDAKTFYEQVDRNHN*
Ga0081455_1000099451	3300005937	Tabebuia Heterophylla Rhizosphere	MKSITSALVALLVIAGVAGAAQAFDTKTFYEQVDRNHN*
Ga0081455_1000868116	3300005937	Tabebuia Heterophylla Rhizosphere	MKTILSALVALSVIAGIAGTANALDAKTFFEQVDRDHN*
Ga0081455_100309791	3300005937	Tabebuia Heterophylla Rhizosphere	MKTILSALVALAVIAGVAGSASAMDAKEFYERVDRTHF*
Ga0081455_100419543	3300005937	Tabebuia Heterophylla Rhizosphere	MKSITSALVALLVIAGVADAAQAFDAKTFYEQVDRNHN*
Ga0081455_106736403	3300005937	Tabebuia Heterophylla Rhizosphere	MKTILSALIALSILAGFAATASAADLDAKTWFEQMDRSRY*
Ga0081540_10000716	3300005983	Tabebuia Heterophylla Rhizosphere	MKTLLSALIALSVIAGVAGSASALDAKTFYEQVDRNHY*
Ga0081540_10000718	3300005983	Tabebuia Heterophylla Rhizosphere	MKTILSALIALSVIAGVAGSASALDAKTFYEQVDRNHH*
Ga0081540_100014852	3300005983	Tabebuia Heterophylla Rhizosphere	MKTILSALVALSVIAGVAGSASAFDAKSFYEQIDRNHN*
Ga0081540_100020536	3300005983	Tabebuia Heterophylla Rhizosphere	MKTIASALVALSLIAAVAGTAQAFDAKTFYEEVDRNHN*
Ga0081540_10005156	3300005983	Tabebuia Heterophylla Rhizosphere	VSRLKTILSALVALSVIAGVTGSASALDVKTFYEQVDRNHY*
Ga0081540_100079426	3300005983	Tabebuia Heterophylla Rhizosphere	MKTILSALVALSVIAGVAGTANALDAKAFFEQIDRDHN*
Ga0081540_100109612	3300005983	Tabebuia Heterophylla Rhizosphere	MKTILSALIALSVLAGFAGSAAADVDAKTFYEQADRDRF*
Ga0081540_10536952	3300005983	Tabebuia Heterophylla Rhizosphere	MKTMLSALVALSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0081540_10704882	3300005983	Tabebuia Heterophylla Rhizosphere	MQTILSALVALSLIAGVVGTASAMDAKTFYEQVDRNHY*
Ga0081540_10704883	3300005983	Tabebuia Heterophylla Rhizosphere	MKIILSALVALSVIAGVTGSASALDAKTFFEQVDRDHN*
Ga0081540_11659452	3300005983	Tabebuia Heterophylla Rhizosphere	MKTITSALVALLVIASVAGTAQAFDAKTFYEQVDRNHN*
Ga0075417_102354653	3300006049	Populus Rhizosphere	MKTILSALVALSVIAGVAGGTVAMDAKEFYERVDRNHF*
Ga0070715_100108007	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MKTSLSVLAALSVIAGVADTASAFDAKTFYEQVDRDHN*
Ga0070715_101849964	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MKTILSALVALSVLAGVAGSASAFDAKSFYEQVDRNHY*
Ga0070715_101849965	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	ILSALVALSVIAGIAGTASALDAKTFYEQVDRDHY*
Ga0070716_1005057182	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MSNAMKTILSALVALSVVAGVAGTANALDAKIFFEQVDRDHN*
Ga0070712_1008536063	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MKTILSALVALSVIAGIAGTASALDAKTFYEQVDRDHY*
Ga0075422_100286742	3300006196	Populus Rhizosphere	MKTILSALVALSVIAGAAGAAIAFDAKDFYERIDRNHN*
Ga0075422_100329132	3300006196	Populus Rhizosphere	MKTITSALLALLVIAGVAGAAEALDAKTFYAQVDRNHN*
Ga0075422_100443493	3300006196	Populus Rhizosphere	MKTVLSALIALSVIASVAGTANALDAKTFFEQVDRDHN*
Ga0075422_101166242	3300006196	Populus Rhizosphere	MKTITSALVALVLLTGIAGSAQALDARSFYDQVDRNHN*
Ga0075422_104448062	3300006196	Populus Rhizosphere	MKTILSALLALSVLAGFAGTAAAAVDAKTFYDQVDRDRF*
Ga0075422_104915403	3300006196	Populus Rhizosphere	MKTILSALIALSVIASVAGTANALDAKTFFEQVDRDHN*
Ga0079222_100521022	3300006755	Agricultural Soil	MKTILSALLALSVIAGVAGSASALDAKTFYEQVDRNHY*
Ga0079222_104412892	3300006755	Agricultural Soil	MKTILSALIALSVIAGVAGSASAFDAKDFYEQVDRNHN*
Ga0079222_107760331	3300006755	Agricultural Soil	MKTILSTLIAQSVLAGFAGTAAANVDAKTFYEQVVRDSL*
Ga0079222_108320792	3300006755	Agricultural Soil	MIMKTILSALVALSVIAGLAGTANALDAKTFWEQIDRDHN*
Ga0079222_108720213	3300006755	Agricultural Soil	MKTILSAVVALSVIVGVAGTANALDAKTFWEQIDRDHN*
Ga0079222_111407282	3300006755	Agricultural Soil	MKTILSALVVLSVVAGVAGTANAAIDAKTFFEQVDRDHN*
Ga0075428_1000120558	3300006844	Populus Rhizosphere	MKTILSALVALSVLAGVAGSASALDAKTFYEQVDRDHN*
Ga0075428_1000416767	3300006844	Populus Rhizosphere	MKTILSVLIALSVIAGVAGTASAMDAKEFYERVDRNHF*
Ga0075428_1002044445	3300006844	Populus Rhizosphere	MKTILSALVALSVVASVAGPANALDAKTFFEQVDRDHN*
Ga0075428_1002639694	3300006844	Populus Rhizosphere	MKTILSALVALSVIASVAGTANALDAKTFFEQVDRDHN*
Ga0075428_1005370271	3300006844	Populus Rhizosphere	KRRMIMKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0075428_1006845793	3300006844	Populus Rhizosphere	MKTILSALIALSVLAGFAGTAAANVDAKTFYDQVDRDHF*
Ga0075428_1020107391	3300006844	Populus Rhizosphere	MKTILSALVALSVIAGIAGSASAFDAKTFYEQVDRDHN*
Ga0075428_1020836831	3300006844	Populus Rhizosphere	MQTITSALVALVLLTGIVGSAQALDARDFYEQVDRYHH*
Ga0075431_1001600452	3300006847	Populus Rhizosphere	MKTILSALVALSVIAGVAGTANALDAKTFFEQVDRNHN*
Ga0075433_1000143616	3300006852	Populus Rhizosphere	MKTVLSALIALSVIASVAGTASALDAKTFFEQVDRDHN*
Ga0075433_100033518	3300006852	Populus Rhizosphere	MKTILSALVALSVIAGVAGSASALDAKTFYQQVDRDHY*
Ga0075433_100054383	3300006852	Populus Rhizosphere	MKTITSALLALLVIAGVAGAAEAIDAKAFYEQVDRNHN*
Ga0075433_100133266	3300006852	Populus Rhizosphere	MKTILSALVALSVIAGVAGSASAFDAKTFYEQVDRDHN*
Ga0075433_102510823	3300006852	Populus Rhizosphere	MQTITSAVVALLLVAGVAGAAQALDAKTFYEEVDRNHN*
Ga0075433_103224822	3300006852	Populus Rhizosphere	MKTILSTLVALSVLAGVAGSASALDAKTFYEQVDRDHN*
Ga0075433_103582131	3300006852	Populus Rhizosphere	MKTILSALVALSVIAGAAGTASALDAKTFFEQIDRDHN*
Ga0075433_118298762	3300006852	Populus Rhizosphere	MIMKTILSALIALSVIAGVAGTANALDAKTFFEQVDRDHN*
Ga0075425_1000043206	3300006854	Populus Rhizosphere	MKTILSALVALSVIAGAAGAATAFDAKDFYERIDRNHN*
Ga0075425_1001167582	3300006854	Populus Rhizosphere	MKTILSALVALSVIAGVAGSASAFDARTFYEQVDRDHN*
Ga0075425_1008111372	3300006854	Populus Rhizosphere	MKTILSALVALSVIAGASATASALDAKSFYEQVDRTHYAK
Ga0075434_1000126761	3300006871	Populus Rhizosphere	IAMKTILSALVALSVIAGVAGSASAFDAKTFYEQVDRDHN*
Ga0075434_1021737281	3300006871	Populus Rhizosphere	MNGEIAMKTITSALVALLVIAGIAGTAQAFDAKTFYEQVDRNHN*
Ga0075434_1025768432	3300006871	Populus Rhizosphere	MKTITSALVALVLLTGIAASAQALDARSFYDLVDRNHN*
Ga0075429_1016457711	3300006880	Populus Rhizosphere	QRRDAMKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0075426_102154981	3300006903	Populus Rhizosphere	MKTILSALVALSVIAGVAGSASAFDAKTFYEQVDR
Ga0075424_10000132223	3300006904	Populus Rhizosphere	LSALVALSVIAGVAGSASAFDAKTFYEQVDRDHN*
Ga0075424_1000119299	3300006904	Populus Rhizosphere	MKTIVSALIALSVLAGVAGTVQAFDAKTFYDQVDRDHN*
Ga0075424_1000981962	3300006904	Populus Rhizosphere	MKTIMSALVALSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0075424_1009299511	3300006904	Populus Rhizosphere	MKTILAALIALSVIASVAGQANALDAKTFFEQVDRDHN*
Ga0075424_1020526121	3300006904	Populus Rhizosphere	EEIAMKTILSALVALSFIAGVAGTANALDAKTFFEQVDRDHN*
Ga0075424_1025735392	3300006904	Populus Rhizosphere	MKTILSALIALSVLAGFAGTAAANVDTKTFYEQVD
Ga0081243_10083633	3300006937	Tropical Rainforest Soil	MKTILSALVALSVIAGVAGSASALDAKTFYEQVDR
Ga0079219_101110112	3300006954	Agricultural Soil	MKTILSALVALSVIAGLAGTANALDAKTFWEQIDRDHN*
Ga0079219_105440522	3300006954	Agricultural Soil	MKTIVSALIALSVIAGIAAPASALDAKSFYEQVDRLHY*
Ga0079219_106186892	3300006954	Agricultural Soil	MKTILSALVALSVIAGIAGSANALDAKTFFEQVDRNHN*
Ga0079219_114094812	3300006954	Agricultural Soil	MKTILSVLVALSVIAGVAGSASAMDAKEFYERVDRNHF*
Ga0105098_102881981	3300009081	Freshwater Sediment	MKTILSALIALSVIAGVASTARAMDAKEFYERVDRNHF*
Ga0111539_100100443	3300009094	Populus Rhizosphere	MIMKTILSALIALSVIAGVAGSASALDAKTFYEQVDRNHY*
Ga0111539_100149254	3300009094	Populus Rhizosphere	MITKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0111539_101629353	3300009094	Populus Rhizosphere	MIMKTILSAVVALSVIVGVAGTANALDAKTFWEQIDRDHN*
Ga0111539_101677671	3300009094	Populus Rhizosphere	MIMKTILSALVAFSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0111539_101865653	3300009094	Populus Rhizosphere	MKTILSALIALSVIASVAGPANALDAKTFFEQVYRDHN*
Ga0111539_101935721	3300009094	Populus Rhizosphere	MKTILSALIALSVIAGVAGTANALDAKTFWEQMDRDHN*
Ga0111539_102574102	3300009094	Populus Rhizosphere	MKTILSALVALSLIAGVAGSASAFDAKDFYELVDRNHN*
Ga0111539_103036272	3300009094	Populus Rhizosphere	MIMKTILSALVALSVIASVAGTANALDAKTFWEQVDRDHN*
Ga0111539_104200892	3300009094	Populus Rhizosphere	MIMKTILSALIALSVIAGIAGSASALDAKTFYEQVDRNHN*
Ga0111539_104956782	3300009094	Populus Rhizosphere	MKTILSALVALSVMAGVAGSASALDAKTFFEQVDRDHN*
Ga0111539_106404342	3300009094	Populus Rhizosphere	MKTILSALVALSVIAGVAGAAVAMDAKEFYERVDRNHF*
Ga0111539_106921311	3300009094	Populus Rhizosphere	MIMKTILSTLVALSVLAGVAGSASALDAKTFYEQVDRNHY*
Ga0111539_116396592	3300009094	Populus Rhizosphere	MKNILSALIALSLIAGVAGGAVAMDAKEFYERVDRNHF*
Ga0111539_123183821	3300009094	Populus Rhizosphere	KTKKRRMIMKTILSTLVALSVLAGVAGSASALDAKTFYEQVDRDHN*
Ga0111539_123852051	3300009094	Populus Rhizosphere	MKTITSALVALLVIAGITGRANAFDAKTFYEQIDRDHN*
Ga0105245_119756911	3300009098	Miscanthus Rhizosphere	MKTILSALVALSVIASVAGPANAFDAKTFFEQVDRDHN*
Ga0075418_100339394	3300009100	Populus Rhizosphere	MIMKTILSALVALSVVASVAGPANALDAKTFFEQVDRDHN*
Ga0075418_100552763	3300009100	Populus Rhizosphere	MKTILSALLALSVLAGFAGTAAANVDAKTFYEQVDRDRF*
Ga0075418_104515442	3300009100	Populus Rhizosphere	MNGEIAMKTITSALVALLVIAGVAGTAQALDAKTFYEQVDRNHN*
Ga0075418_105699561	3300009100	Populus Rhizosphere	TILSALVALSVLAGVAGSASALDAKTFYEQVDRDHY*
Ga0075418_105699562	3300009100	Populus Rhizosphere	MIMKTILSALVALSVLAGVAGSASALDAKTFYEQVDRDHN*
Ga0075418_110864362	3300009100	Populus Rhizosphere	ILSALVALSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0075418_122410901	3300009100	Populus Rhizosphere	MTGDVAMQTITSALVALLLVAGVAGAAQALDAKTFYEEVDRNHN*
Ga0075418_126628871	3300009100	Populus Rhizosphere	MQTITSAAFIALMLLTGIAGAAQALDAKSFYEQVDRSHN*
Ga0105091_101249371	3300009146	Freshwater Sediment	MKTITSALVALLVITGATGTASAFDAKTFYEQVDRNHN*
Ga0105091_104425221	3300009146	Freshwater Sediment	MKAKGETAMQTILSALVALLVIAGVAGAAHALDAKSFYEEIDRTHY*
Ga0105091_104707512	3300009146	Freshwater Sediment	MKTILSALIALSVIAGVAGSASALDAKTFFEQIDRDHN*
Ga0114129_100687881	3300009147	Populus Rhizosphere	MKTILSALVALSVIAGVAGTASALDAKTFFEQVDRDHN*
Ga0114129_101793242	3300009147	Populus Rhizosphere	MKTIMSAVVALSVIASVAGTANALDAKTFFEQVDRDHN*
Ga0114129_101948902	3300009147	Populus Rhizosphere	MQTITSALVALVLLTGIASSAQALDARSFYEQVDRNHN*
Ga0114129_103323034	3300009147	Populus Rhizosphere	MIMKTILSALVALSVVASVAGPANALDAKTFFEQVDRGHN*
Ga0114129_124099271	3300009147	Populus Rhizosphere	ILSVLIALSVIAGVAGTASAMDAKEFYERVDRNHF*
Ga0111538_100703403	3300009156	Populus Rhizosphere	MKTIMSALVALSVIASVAGQANALDAKTFFEQVDRDHN*
Ga0111538_101555271	3300009156	Populus Rhizosphere	TITSAFVALLVIAGAVGTAKAFDAKIFYEQVDRNRN*
Ga0111538_102380094	3300009156	Populus Rhizosphere	DAMKTILSALVALSVIASVAGGAVAMDAKEFYERVDRNHF*
Ga0111538_102498781	3300009156	Populus Rhizosphere	MIMKTILSAFVALSVIASVAGTANALDAKTFFEQVDRDHN*
Ga0111538_102793941	3300009156	Populus Rhizosphere	MKIILSALVALSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0111538_102808375	3300009156	Populus Rhizosphere	MIMKTILSALVALSVLAGVAGSASALDAKAFYEQVDRDHN*
Ga0111538_104148141	3300009156	Populus Rhizosphere	TILSALIALSVIAGVAGSASALDAKTFYEQVDRNHN*
Ga0111538_107160922	3300009156	Populus Rhizosphere	MIMKTILSALVALSVIAGVAGTANALDAKSFYEQVDRDHY*
Ga0111538_113581892	3300009156	Populus Rhizosphere	SRIRGEIAMKTILSALVALSVIAGVAGSASAFDAKTFYEPVDRDHN*
Ga0111538_115307402	3300009156	Populus Rhizosphere	MKTITSALLALLVIAGVAGAAEALDAKAFYEQVDRNHN*
Ga0111538_117827252	3300009156	Populus Rhizosphere	MNTTMSALVALLVIAGVAGSAKAFDAKTFYEQVERDRN*
Ga0111538_122147673	3300009156	Populus Rhizosphere	MIMKTMLSALIALSVIAGVAGSASALDAKTFYEQVDRDHN*
Ga0111538_122147674	3300009156	Populus Rhizosphere	TMLSALIALSVIAGVAGSASALDAKTFYEQVDRNHY*
Ga0075423_100109232	3300009162	Populus Rhizosphere	MKTVLSALIALSVIASVGGTASALDAKTFFEQVDRDHN*
Ga0105241_109460312	3300009174	Corn Rhizosphere	MKTILSALLAHSVIASVVGPANALDAKTFFEQVDRDHN*
Ga0105241_116311442	3300009174	Corn Rhizosphere	MTMKTILSALVALSAIASVAGTANALDAKTFFEQVDRDHN*
Ga0105241_126544292	3300009174	Corn Rhizosphere	SNKKRRMIMKTMLSALIALSVIAGVAGSASALDAKTFYEQVDRNHN*
Ga0126374_100187082	3300009792	Tropical Forest Soil	MRTIASALLALLVIVGIAGSADAFDAKSFYQQVDRDHN*
Ga0126374_101219003	3300009792	Tropical Forest Soil	MIMKTILSALVAISVIAGVAGSASALDAKTFFEQIDRDHN*
Ga0126374_102337312	3300009792	Tropical Forest Soil	MNTILSALVALSVIAGVAGTANAFDAKSFYEQVDRNHN*
Ga0126374_102869871	3300009792	Tropical Forest Soil	MKTILSALVALSVIAGVAGTASALDAKSFYEQVDRD
Ga0126374_102869872	3300009792	Tropical Forest Soil	MKTILSALVALSVIAGVAGTASAFDAKTFYEQVDRNHN*
Ga0126374_103595103	3300009792	Tropical Forest Soil	MIMKLIMSALVALSVIAGVAGTANAFDTKTFFEQVDRDH
Ga0126374_108830822	3300009792	Tropical Forest Soil	MIMKTILSAIVALSVIAGVAGSASAALDAKTFFEQVDRDHN*
Ga0126374_116402221	3300009792	Tropical Forest Soil	MKSILSALVALSVIAGVAGLASAFDAKTFYEQIDRNGN*
Ga0126380_100204138	3300010043	Tropical Forest Soil	MKTILSALVAFSVIGGIAGSAKALDAKTFYEQVDRNHYAKNDD
Ga0126380_100223416	3300010043	Tropical Forest Soil	MKTITSAFVALLVIAAVAGSASAFDAKTFYEQVDRNHN*
Ga0126380_100632243	3300010043	Tropical Forest Soil	MKTILSAVVALSVIAGVTGTVSAFDAKDFYEQVDRNHN*
Ga0126380_101734512	3300010043	Tropical Forest Soil	MKTILSALLALSMIAGVAGSASAMDAKEFYERVDRNHF*
Ga0126380_102892492	3300010043	Tropical Forest Soil	MKTILSLIALSVIAATAGTASAFDAKDFYEQVDRNHN*
Ga0126380_104788642	3300010043	Tropical Forest Soil	MIMKTILSALVALSVIAGVAGSASALDAKAFFEQIDRDHN*
Ga0126384_1000011135	3300010046	Tropical Forest Soil	IMKTILSALVALSVIAGVAGTASAFDAKSFYEQVDRDHN*
Ga0126384_1000055626	3300010046	Tropical Forest Soil	MKTILSALVALSVIAGVAGSARALDAKIFFEQVDRDHN*
Ga0126384_100324554	3300010046	Tropical Forest Soil	MKTILSALVALSVIAGVAGTASAFDAKSFYEQVDRDHN
Ga0126384_101738364	3300010046	Tropical Forest Soil	MKTILSALVALSVIASSASALDAKTFFEQVDRDHN*
Ga0126384_121594091	3300010046	Tropical Forest Soil	MKAILSALVALSVIAGVAGSASALDAKTFYEQVDRNHN*
Ga0126384_121594092	3300010046	Tropical Forest Soil	MIMKTILSALIALSVIAGVAGSASALDAKSFYEQVDRNHN*
Ga0126382_100103032	3300010047	Tropical Forest Soil	MIMKTILSALVALSLIAGVAASASAFDPKAFFDQVDREHN*
Ga0126382_100103033	3300010047	Tropical Forest Soil	MIMKTILSALLALSVIAGVAGSASALDAKSFYEQVDRDHN*
Ga0126382_100103594	3300010047	Tropical Forest Soil	MKIILSALVALSVIAGVAGSASAMDAKEFYERVDRNHF*
Ga0126382_100116135	3300010047	Tropical Forest Soil	MKTILSALVALSVIAGVAGSSSAMDAKEFYEQVDRNHF*
Ga0126382_100201137	3300010047	Tropical Forest Soil	LSALVALSLIAGVAGSASALDAKSFYEQVDRDHY*
Ga0126382_100378283	3300010047	Tropical Forest Soil	MKTILSALVALAVIAGVAGTASAFDPKAFYEQIDRDHN*
Ga0126382_100508533	3300010047	Tropical Forest Soil	MKTILSALVALSVITGVAGTASAFDARTFYEQIDRDHN*
Ga0126382_100516845	3300010047	Tropical Forest Soil	MKTILSALVALSVIAGVAGSANALDAKTFFEQVDRDHN*
Ga0126382_100577615	3300010047	Tropical Forest Soil	MIMKTILSALLALSVIAGVAGSASALDAKTFYEQVDRDHN*
Ga0126382_101662671	3300010047	Tropical Forest Soil	MKTILSALVALSVIAGVAGSARALDAKTFFEHVDRDHN*
Ga0126382_102200473	3300010047	Tropical Forest Soil	MIMKTILSALVALSLIAGVAGSASALDAKTFFEQVDRDHN*
Ga0126382_102500671	3300010047	Tropical Forest Soil	MKTITSALVALLVIAGAAGIANALDAKTLYEQVDRNRN*
Ga0126382_103897001	3300010047	Tropical Forest Soil	MKTITSALVALVLLTGITGSAHALDAKSFYEQVDRKHN*
Ga0126382_105483301	3300010047	Tropical Forest Soil	MKTMLSALVALSVIAGVAGSASALDAKTFYEQVDRDHN*
Ga0126382_105483302	3300010047	Tropical Forest Soil	MKAILSTLLALSVIAGVAGSASALDAKTFYEQVDRNHY*
Ga0126382_106146372	3300010047	Tropical Forest Soil	MIMKIILSALVALSVIAGVAGSASALDAKTFFEQVDRDHN*
Ga0126382_106616891	3300010047	Tropical Forest Soil	MKTVLSAFVAVLVMAGVAGTASAIDAKTFYEQVDRNHY*
Ga0126382_106649203	3300010047	Tropical Forest Soil	RGEIAMKTILSALVALSVIAGVAGTASALDAKTFFEQVDRDHN*
Ga0126382_107452763	3300010047	Tropical Forest Soil	MIMKTILSALVALSVVTGVAGTANALDAKTFWEQIDRDHN*
Ga0126382_112409582	3300010047	Tropical Forest Soil	MIMRTILSALVALSVIAGVAGSASALDAKSFYEQVDRNHY*
Ga0126382_115465132	3300010047	Tropical Forest Soil	MKTILSALVALSVIAGVAGSANALDAKAFFEQIDRDHN*
Ga0126382_120361691	3300010047	Tropical Forest Soil	MKTILSALIALSVLAGFVGSAAADVDAKALYEQMDRDRF*
Ga0126382_120554661	3300010047	Tropical Forest Soil	MKTITSALVALLVIAGVAGAAQAFDAKTFYEQVDRNHN*
Ga0126382_121981981	3300010047	Tropical Forest Soil	MKTITSALVALLVIAGVAGAAQASDAKSFYEQVDRNHN*
Ga0126370_113243881	3300010358	Tropical Forest Soil	KTMLSALVALSVIAGVAGSASAMDAKEFYEQVDRNHF*
Ga0126370_113243882	3300010358	Tropical Forest Soil	MIMKLIMSALVALSVIAGVAGTANAFDTKTFFEQVDRDHN*
Ga0126370_121318742	3300010358	Tropical Forest Soil	MKILLSALLALSVIAGVAGSASAMDAKEFYERVDRNHF*
Ga0126376_100076038	3300010359	Tropical Forest Soil	MKTILSALIALSVIAATAGTASAFDAKDFYEQVDRNHN*
Ga0126372_101869751	3300010360	Tropical Forest Soil	LSALVALSVIAGVAGSASALDAKTFFEQIDRNHN*
Ga0126372_103167683	3300010360	Tropical Forest Soil	MKTITSALVALLLIAGVAGAAQALDAKTFYEQVDRNHN*
Ga0126372_104672032	3300010360	Tropical Forest Soil	VKAILSALVGLSVIAGVAGNASALDAKTFFEQVVSDRN*
Ga0126372_108494581	3300010360	Tropical Forest Soil	MKTSLSALVALLVIAGAAGTASALDAKTFFEQIDRDHN*
Ga0126372_116103392	3300010360	Tropical Forest Soil	MKTILSALVALSVIAGVAGTASAFDTKTFYEQLDRERNYR*
Ga0126372_122343011	3300010360	Tropical Forest Soil	ILSALVALAVIAGVAGSASAFDTKTFYEQIDRDHN*
Ga0126372_124339962	3300010360	Tropical Forest Soil	MIMKTILSALVALSVMAGVAGSASALDAKTFFEQIDRDHN*
Ga0126377_1000225211	3300010362	Tropical Forest Soil	MKTILSALVAVSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0126377_100076513	3300010362	Tropical Forest Soil	MIMKLILSALVALSVIAGVAGSASALDAKTFFEQVDRDHN*
Ga0126377_100076514	3300010362	Tropical Forest Soil	MKTILSALVALLVIAGVAGSASAMDAKAFYEQVDRNHY*
Ga0126377_100099019	3300010362	Tropical Forest Soil	MKTMLCALVALSVIAGVTGTASAFDAKDFYERVDRNHN*
Ga0126377_100200591	3300010362	Tropical Forest Soil	MIMKTILSALVALSVIAGVAGPANALDAKTFFEQIDRDHN*
Ga0126377_100304603	3300010362	Tropical Forest Soil	MKTITSALFALLLIAGVAGTAQAYDAKAFFEQVDRNHN*
Ga0126377_100896992	3300010362	Tropical Forest Soil	MKTITSALVALLVIATVAGTAQAFDAKTFYEQVDRNHN*
Ga0126377_101100642	3300010362	Tropical Forest Soil	MKTITSALVALLVIAGVAGTAQALDAKTFYEQIDRNHN*
Ga0126377_102675424	3300010362	Tropical Forest Soil	MKSILSALVALSVIAGVAGSASAFDAKTFYEQIDRNGN*
Ga0126377_103508422	3300010362	Tropical Forest Soil	MKTILSALLALSVIAGVAGSASAMDAKEFYEQVDRNHY*
Ga0126377_103660683	3300010362	Tropical Forest Soil	MKTILSALVALSLIAGVAGSANAFDAKAFYEQVDRDHN*
Ga0126377_105414661	3300010362	Tropical Forest Soil	MKTIVSALVALAVIAGVAGTANAAIDAKTFFEQVDRDHN*
Ga0126377_106465972	3300010362	Tropical Forest Soil	MIMKTILSALVALSVIAGVAGTATALDAKTFWEQIDRNHN*
Ga0126377_106563823	3300010362	Tropical Forest Soil	MIMKTILSALVALSVIAGVAGTANALDAKAFWERIDRDHN*
Ga0126377_106989621	3300010362	Tropical Forest Soil	MKTILSALIALSVIAGVAGAASALDAKTFYEQVDRNHY*
Ga0126377_109945351	3300010362	Tropical Forest Soil	MKTILSALVALSVIAGVAGSASAMDAREFYERVDRNHF*
Ga0126377_109945352	3300010362	Tropical Forest Soil	MIMKTILSALVALSVIAGAAGTANALDAKTFWEQIDRDHN*
Ga0126377_110921821	3300010362	Tropical Forest Soil	TILSALVALSVIAGVAGTASAFDAKSFYEQVDRDHN*
Ga0126377_111920451	3300010362	Tropical Forest Soil	MKTILSAMIALSVLAGFAGSAAADVDAKTFYEQADRDRY*
Ga0126377_119585111	3300010362	Tropical Forest Soil	SALIALSVLAGFAGTAAANVDAKTFYEQVDRDRF*
Ga0126377_119977512	3300010362	Tropical Forest Soil	MKTITSALAALLLITGVAGSAHAFDAKTFYEQVDRDRN*
Ga0126377_120087111	3300010362	Tropical Forest Soil	KRRMIMKTILSALVALSVIAGVAGSATALDAKTFFEQIDRDHN*
Ga0126377_127590831	3300010362	Tropical Forest Soil	MKAILSTLVALSVIASVTGPANALDAKTFFEQVDRNHN*
Ga0126377_129668902	3300010362	Tropical Forest Soil	MIMKTILSALIALSVIAGVAGSASAFDARAFYEQIDRNHN*
Ga0126377_131044141	3300010362	Tropical Forest Soil	MKTILSALIALSVVAGVAGTASAFDAKDFYERIDRNHN*
Ga0126377_132759241	3300010362	Tropical Forest Soil	LGALRGEIAMKIILSALLALSVIAGVAGSASAMDAREFYERVDRNHF*
Ga0126377_134528731	3300010362	Tropical Forest Soil	AMKIILSALVALSLIAGVAGSASALDAKTFFEQIDRDHN*
Ga0126379_114421882	3300010366	Tropical Forest Soil	MKTILSALVALSVIAGVAGTASAMDAKEFYERVDRNHF*
Ga0126379_114421883	3300010366	Tropical Forest Soil	MIMKTILSALVALSVIAGAAGSASALDAKTFYEQVDRNHY*
Ga0126379_114421884	3300010366	Tropical Forest Soil	MIMKTILSALVALSVIAGVAGSASALDAKTFYEQVDRDH
Ga0134125_108364051	3300010371	Terrestrial Soil	MIMKTILSALVALSVIASVAGTANALDAKSFFEQV
Ga0134125_126625823	3300010371	Terrestrial Soil	DGKKRRAPMKAILSALLALSVIAGVAGSASALDAKTFYEQVDRNHF*
Ga0134126_108927802	3300010396	Terrestrial Soil	MKTILSALIALSVIASVAGSASALDAKTFYEQVDRDHN*
Ga0134126_112215571	3300010396	Terrestrial Soil	MIMKTILSALIVLSVIASVAGSASALDAKTFYEQVDSNHF*
Ga0134127_134609161	3300010399	Terrestrial Soil	MKAILSALLALSVIAGVAGSASALDAKTFYEQVDRNHF*
Ga0134122_100030245	3300010400	Terrestrial Soil	MIMKTILSALIALSVIASVAGSASALDAKTFYEQVDSNHF*
Ga0134122_100030246	3300010400	Terrestrial Soil	MIMKTILSALIALSVIASVAGSASAFDAKTFYEQVDRDHN*
Ga0134122_111635553	3300010400	Terrestrial Soil	MKTITSALVALVLLTGIAGSAQALDARSFYEQVDRNHR*
Ga0134122_133569033	3300010400	Terrestrial Soil	MKTILSALIAFSVIAGVAGSASALDAKTFYEQVDR
Ga0134123_133027251	3300010403	Terrestrial Soil	MKTILSALVALSVIASATGPANALDAKTFFEQVDRD
Ga0134123_133835461	3300010403	Terrestrial Soil	MTMKTILSALVALSAIASVAGTANALDAKSFFEQVDRDHN*
Ga0157337_10059591	3300012483	Arabidopsis Rhizosphere	MKTILSALVGLSVIAGIAGSASAFDAKTFYEQVDRDHN*
Ga0157331_10380212	3300012486	Soil	MIMKTILSALIALSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0157335_10230701	3300012492	Arabidopsis Rhizosphere	MKTILSALVALSVIAGVVGAAVAMEAKEFYERVDRNHF*
Ga0157355_10425552	3300012493	Unplanted Soil	EIAMKTILSALIALSVIAGVAGTASAMDAKEFYERVDRNHF*
Ga0157313_10608802	3300012503	Arabidopsis Rhizosphere	RRDIMKTILSALVALSVIAGVAGGAVAMDAKEFYERVDRNHF*
Ga0157326_10670641	3300012513	Arabidopsis Rhizosphere	MKTILSALVALSVIASVVGPANALDAKTFFEQVDRDHN*
Ga0126375_100050193	3300012948	Tropical Forest Soil	MKTILSALVALSLIAGFAGGASAMDAKEFYEQVDRNHY*
Ga0126375_100050194	3300012948	Tropical Forest Soil	MIMKTILSALIALAVIAGVAGSASALDAKTFFEQIDRDHN*
Ga0126375_100720155	3300012948	Tropical Forest Soil	MKTILSALVALSVIAGVAGTASAFDAKSFYEQIDRNHN*
Ga0126375_101051423	3300012948	Tropical Forest Soil	MIMKTILSALVGLSVIAGVAGSASALDAKTFYEQVDRDHN*
Ga0126375_101398133	3300012948	Tropical Forest Soil	MIMKTILSALLALSVIAGVAGSASALDAKSFYEQVDR
Ga0126375_101795841	3300012948	Tropical Forest Soil	DQREIAMKTILSALIALSVIAATAGTASAFDAKDFYEQVDRNHN*
Ga0126375_102162503	3300012948	Tropical Forest Soil	MIMKTILSALVALSVIAGVAGSASAMDTKEFYERVDRNHF*
Ga0126375_102162504	3300012948	Tropical Forest Soil	MKTILSALIAISVIAGVAGSASAMDTKEFYERVDRNHF*
Ga0126375_104055122	3300012948	Tropical Forest Soil	MIMKIILSALVALSVIAGVAASASALDAKTFFEQVDRDHN*
Ga0126375_104785832	3300012948	Tropical Forest Soil	MKTILSALVALSVIAGVVGSASAMDAKEFYERVDRNHF*
Ga0126375_108526671	3300012948	Tropical Forest Soil	EIAVKTVLSALVALSVIAGVASTASAFDAKSFYEQIDRDHN*
Ga0126375_110204261	3300012948	Tropical Forest Soil	MKTSLSALVAPLVIAGAAGTASALDAKTFFEQIDRDHN*
Ga0126375_112313972	3300012948	Tropical Forest Soil	MKTILSALVALSVIANVAGPANALDAKTFFEQVDRDHN*
Ga0126375_113870831	3300012948	Tropical Forest Soil	KTITSALVALLVIAGAAGIANALDAKTLYEQVDRNRN*
Ga0126375_119835182	3300012948	Tropical Forest Soil	MKTILSALVALSFFAGVAGSANAFDAKAFYEQVDRDHN*
Ga0164303_109820501	3300012957	Soil	MKTSLAALGALSVIAGIAGTASALDAKTFYEQVDRDHY*
Ga0164301_108267402	3300012960	Soil	MKTTILSVLAALSVIAGVADTASAFDAKTFYEQVDRDH
Ga0126369_108931433	3300012971	Tropical Forest Soil	MIMKTILSALVALSVIAGVAGTANALDAKTFWEQIDRDHN*
Ga0164304_103238551	3300012986	Soil	MKTILSALVALSVVAGVAGTANALDAKTFFEQVDRDHN*
Ga0132258_1000152930	3300015371	Arabidopsis Rhizosphere	MIMKTILSALVALSVIAGVAGAASALDAKTFYEQVDRDHN*
Ga0132258_1000303528	3300015371	Arabidopsis Rhizosphere	MKTITSALVVLLVIAGVAGSASAFDAKDFYEQVDRNHN*
Ga0132258_1000361833	3300015371	Arabidopsis Rhizosphere	MNGEIAMKTITSALVALLLIAGVAGTAQAFDAKTFYEQLDRNHN*
Ga0132258_1000361834	3300015371	Arabidopsis Rhizosphere	MNGEIAMKTITSALVALLLIAGVAGTAQAFDAKTFYEQADRNHN*
Ga0132258_1000597613	3300015371	Arabidopsis Rhizosphere	MKTITSVLVALVLLTGITGSAKALDARSFYDQVDRNHN*
Ga0132258_1001051321	3300015371	Arabidopsis Rhizosphere	MIMKTILSALVALSVIASVAGTANALDAKTFFEQVDRDHN*
Ga0132258_1001364913	3300015371	Arabidopsis Rhizosphere	MKTILSALLALSVLAGFAGTAAADVDAKTFYETVDRDRF*
Ga0132258_100249319	3300015371	Arabidopsis Rhizosphere	MTGDVAMQTITSALIALLLVAGLASTAQALDAKTFYGEVDRNRN*
Ga0132258_100786253	3300015371	Arabidopsis Rhizosphere	MKAILSALVALSVIAGAAGAATAFDAKDFYERIDRNHN*
Ga0132258_101360804	3300015371	Arabidopsis Rhizosphere	MKTITSALLALLVIAAVAGAAEALDAKTFYEQVDRDHN*
Ga0132258_103242192	3300015371	Arabidopsis Rhizosphere	MKTILSALVALSVIAGIAGGAVAMDAKEFYERVDRNHF*
Ga0132258_103377807	3300015371	Arabidopsis Rhizosphere	MKTILSALLAHSVIASVVGPANALDATTFFEQVDRDHN*
Ga0132258_113571511	3300015371	Arabidopsis Rhizosphere	MMMKTILSALVALSVIAGVGGSASALDAKTFFEQIDRDHN*
Ga0132258_113571512	3300015371	Arabidopsis Rhizosphere	MKTLLSALVALSVIAGVAGTASAMDAKEFYERVDRNHF*
Ga0132258_113764533	3300015371	Arabidopsis Rhizosphere	MKTILSALIALSVIAGTASAFDAKSFYEQVDREHN*
Ga0132258_116570971	3300015371	Arabidopsis Rhizosphere	MQTITSASVALLVIAGAVGTAKAFDAKIFYEQVDRNRN*
Ga0132258_122158712	3300015371	Arabidopsis Rhizosphere	MKTILSALVALSIIAGVAGSASAFDAKTFYEQVDRDHN*
Ga0132258_123001382	3300015371	Arabidopsis Rhizosphere	MKRILSVLVALSVIAGVAGSASAMDAKEFYERVDRNHF*
Ga0132258_123001383	3300015371	Arabidopsis Rhizosphere	MMMKTILSALVALSVIAGLAGTANALDARTFWEQIDRDHN*
Ga0132258_125814254	3300015371	Arabidopsis Rhizosphere	MKTILSALVALSVIASVTGPANALDAKTFFEQVDRDHN*
Ga0132256_1011803052	3300015372	Arabidopsis Rhizosphere	MKTILSALVALSVIAGIAGSASAFDAKDFYEQVDRNHN*
Ga0132256_1021233382	3300015372	Arabidopsis Rhizosphere	MKTITSALLALLVIAGVAGAVEALDAKTFYEQVDRNHN*
Ga0132256_1024180551	3300015372	Arabidopsis Rhizosphere	MIMKTMLSALVALSVIASVAGPANALDAKTFFEQVDRDHN*
Ga0132257_1008365473	3300015373	Arabidopsis Rhizosphere	MKTILSALIALSVIASVAGPANVLDAKTFFEQVDRDHN*
Ga0132257_1010631021	3300015373	Arabidopsis Rhizosphere	MKTILSALVALSVIVSVAGPANALDAKTFFEQVDRDHN*
Ga0132257_1015883063	3300015373	Arabidopsis Rhizosphere	MIMKTILSALIALSVIAGVAVSASALDAKTFYEQVDRNHY*
Ga0132255_1000815553	3300015374	Arabidopsis Rhizosphere	MIMKTILSALVALSVIAGVAGAASALDAKTFYEQVDRNHY*
Ga0132255_1004529952	3300015374	Arabidopsis Rhizosphere	MKPITSAFVALLVIAGAVGTAKAFDAKIFYEQVDRNRN*
Ga0132255_1007220432	3300015374	Arabidopsis Rhizosphere	MNGEIAMKTITSALVALLLIAGVAGTAQAFDAKTFFEQADRNHN*
Ga0132255_1018763682	3300015374	Arabidopsis Rhizosphere	MKTILSALVALSVIAGVAGGAAAMDAKEFYERVDRNHF*
Ga0132255_1058481931	3300015374	Arabidopsis Rhizosphere	RGEIAMKTILSALVALSVIAGVAGSASALDAKTFFEQVDRDHN*
Ga0182038_109495092	3300016445	Soil	MKTIVLAFITLSVLAGIVGSASALDAKTFYEQQDRAQN
Ga0163161_104613041	3300017792	Switchgrass Rhizosphere	MKTILSALVALLVIAGVAGTASAMDAKTFYEQVDRNH
Ga0187783_103513242	3300017970	Tropical Peatland	MKTILAALIVLSALAGVAGSASALDPKGFYDQQDRSRW
Ga0187783_104394692	3300017970	Tropical Peatland	MKTIILALFTLSVLAGITGSASALDAKTFYEQQDRAHY
Ga0184612_101467872	3300018078	Groundwater Sediment	MKTIVSALIALSVITSVSAPASAFDAKTFFEQVDRNQP
Ga0184625_102268981	3300018081	Groundwater Sediment	MKTILSALVALSVLAGITGPLAAADDAKIFWEQQDRARY
Ga0190272_120832111	3300018429	Soil	IVSALLALSVIAGVATSASALDAKTFYEQVDKSHF
Ga0190272_120832112	3300018429	Soil	MKTIVSALLALSVIAGVATSASALDAKTFYEQQDKGRF
Ga0190270_115606141	3300018469	Soil	MKTILSALVALSVLAGISGPLAAADDAKIFWEQQDRARH
Ga0190274_129438171	3300018476	Soil	RRTAMKTIVSALIALSVIAGVAAPASALDAKTFWQQQDASHN
Ga0180106_11591324	3300019212	Groundwater Sediment	QKEMIMKAILSALVALSVVTGAAASANAFDAKTFYEQLDSVRS
Ga0184645_11336444	3300019233	Groundwater Sediment	MKTIVSALIALSVIAGIAAPASASVDAKAFYEKLDRSVN
Ga0184645_12325312	3300019233	Groundwater Sediment	MKTILSALIALSVVAGVASAPASAFDAKTFYEQRDQAGIN
Ga0184645_12325313	3300019233	Groundwater Sediment	MKTILSALVALTVIAGVASAPASALDARQFYNQVDTAGIN
Ga0190264_107053872	3300019377	Soil	MKTIVSALLALSVIAGVATSASALDAKTFYEQVDKSHF
Ga0242660_12481661	3300022531	Soil	NRRKVMKTILSALLALSVIAGVATSASALDAKTFYTQQDASRY
Ga0242662_101678371	3300022533	Soil	ALAPIRRTIMKIILSALFDLSVLAGVATSASALDAKAFYQQVDHNGQPG
Ga0207654_105027771	3300025911	Corn Rhizosphere	MKTILSALVALSVIAGIAGSASAFDAKDFYEQVDRNHN
Ga0207663_102423052	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MKTILSVLAALSVIAGVADTASAFDAKTFYEQVDRDH
Ga0207690_112730711	3300025932	Corn Rhizosphere	MKTILSALVALSVIAGVAGGAVAMDAKEFYERVDRNHF
Ga0207706_108934532	3300025933	Corn Rhizosphere	MKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN
Ga0207709_112824932	3300025935	Miscanthus Rhizosphere	MKTITSALAALLVIAAVAGTAQAFDAKTFYEQVDRNHN
Ga0207665_105533971	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MSNAMKTILSALVALSVVAGVAGTANALDAKIFFEQVDRDHN
Ga0207668_106297131	3300025972	Switchgrass Rhizosphere	MKTILSALVALLVIAGVAGTASAMDAKTFYEQVDRNHY
Ga0207668_106297132	3300025972	Switchgrass Rhizosphere	MKIILSALVALSVIASVAGSASALDAKTFFEQIDRDHN
Ga0207668_111580271	3300025972	Switchgrass Rhizosphere	TEKKRRAPMKAILSALLALSVIAGVAGSASALDAKTFYEQVDRNHF
Ga0207668_111580272	3300025972	Switchgrass Rhizosphere	MKTILSALIALSVIAGVAGSASAFDAKTFYEQVDRDHN
Ga0207668_120753011	3300025972	Switchgrass Rhizosphere	LSKRRMIMKTILSALVALSVIASVAGKANALDAKSFFEQVDRDHN
Ga0207678_101432522	3300026067	Corn Rhizosphere	MKTILSALVALSVIAGIAGSASAFDAKDFYEQVDR
Ga0207678_102729631	3300026067	Corn Rhizosphere	MKATLSALLALSVIAGVAGSASALDAKTFYEQVDRNHY
Ga0207678_103443661	3300026067	Corn Rhizosphere	MKTILSALIALSVLAGFAGNAAANVDAKSFYEQVDRDRF
Ga0207678_103452842	3300026067	Corn Rhizosphere	MKTILSALIALSVIASVAGPANALDAKTFFEQVDRDHN
Ga0207678_111980762	3300026067	Corn Rhizosphere	TITSALVALVLLTGIAGSAQALDARSFYEQVDRNHN
Ga0207678_117972482	3300026067	Corn Rhizosphere	MAMKTITSVLVALLVIAGVAGAAQAFDAKAFYERVDRSHN
Ga0207708_100119406	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MKTILSALIALSVLAGFAGSAAADVDAKTLYEQMDRDRF
Ga0207708_100275412	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MKTILSALVALSVIASVAGTANALDAKSFFEQVDRDHN
Ga0207708_102374813	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MKTILSALVALSVIASATGPANALDAKTFFEQVDRDHN
Ga0207675_1005696461	3300026118	Switchgrass Rhizosphere	MKTILSALVALSVIASAAGPANALDAKTFFEQVDRDHN
Ga0209466_10966411	3300027646	Tropical Forest Soil	MIMKTILSALVALSVIAGVVGSASAMDAKEFYERVDRNHF
Ga0209466_10966412	3300027646	Tropical Forest Soil	MIMKTILSALIALSVIAGVAGSASAMDAKEFYERVDRNHF
Ga0209466_11083851	3300027646	Tropical Forest Soil	MKTITSALVALLVIAGVAGAAQAFDTKTFYEQLDRDHN
Ga0209177_100223281	3300027775	Agricultural Soil	MKTILSALVALSVIAGLAGTANALDAKTFWEQIDRDHN
Ga0209177_100223282	3300027775	Agricultural Soil	MKTILSALVALSVIAGVAGSASAMDAKEFYERVDRNHF
Ga0209177_100362701	3300027775	Agricultural Soil	MKTILSALVALSVIAGIAGSANALDAKTFFEQVDRNHN
Ga0209074_101429892	3300027787	Agricultural Soil	MKTMLSALIALSVIAGVAGSASALDAKTFYEQVDRDHN
Ga0209074_102994772	3300027787	Agricultural Soil	MKTILSALLALSVIAGVAGSASALDAKTFYEQVDRNHY
Ga0209074_103055781	3300027787	Agricultural Soil	MKTILSAVVALSVIVGVAGTANALDAKTFWEQIDRDHN
Ga0209074_104262011	3300027787	Agricultural Soil	MKTITSALVALLVIAGIAGTAQAFDAKTFYEQVDRNHN
Ga0209814_101366253	3300027873	Populus Rhizosphere	MKTILSALVALSVIAGVAGGTVAMDAKEFYERVDRNHF
Ga0209814_103489221	3300027873	Populus Rhizosphere	MKTILSVLIALSVIAGVAGTASAMDAKEFYERVDRNHF
Ga0207428_100146974	3300027907	Populus Rhizosphere	MKTILSALVALSVIAGVAGSASAFDARTFYEQVDRDHN
Ga0207428_100150843	3300027907	Populus Rhizosphere	MKTVLSALIALSVIASVAGTASALDAKTFFEQVDRDHN
Ga0207428_100219956	3300027907	Populus Rhizosphere	MKTIVSALLALSVLAGVAGTVQAFDAKTFYDQVDRDHN
Ga0207428_100219957	3300027907	Populus Rhizosphere	MKTILSALIALSVIAGVAGSASALDAKTFYEQVDRNHY
Ga0207428_100219958	3300027907	Populus Rhizosphere	MKTILSALVALSVIAGVAGSASALDAKTFYQQVDRDHY
Ga0207428_100254054	3300027907	Populus Rhizosphere	MKTILSALVALSVIAGAAGAATAFDAKDFYERIDRNHN
Ga0207428_101418714	3300027907	Populus Rhizosphere	TILSALVALSVIAGVAGSASAFDAKTFYEQVDRDHN
Ga0207428_101435492	3300027907	Populus Rhizosphere	MKTILSALVAFSVIASVAGPANALDAKTFFEQVDRDHN
Ga0207428_101761192	3300027907	Populus Rhizosphere	MQTITSAAVIALMLLTGIAGAAQALDAKSFYEQVDRNHN
Ga0207428_101921601	3300027907	Populus Rhizosphere	MKTILSALVALSLIAGVAGSASAFDAKDFYELVDRNHN
Ga0207428_103104621	3300027907	Populus Rhizosphere	MQTITSAVVALLLVAGVAGAAQALDAKTFYEEVDRNHN
Ga0207428_104142263	3300027907	Populus Rhizosphere	AKSMKTITSALLALLVIAGVAGAAEAIDAKAFYEQVDRNHN
Ga0207428_104319922	3300027907	Populus Rhizosphere	MTGDVAMQTITSALVALLLVAGVAGAAQALDAKTFYEEVDRNHN
Ga0207428_104571384	3300027907	Populus Rhizosphere	KTIVSALIALSVLAGVAGTVQAFDAKTFYDQVDRDHN
Ga0207428_105693112	3300027907	Populus Rhizosphere	MKTILSALVALSVIAGAAGTASALDAKTFFEQIDRDHN
Ga0207428_106118912	3300027907	Populus Rhizosphere	MKTILSALVALSVIAGIAGSASAFDAKTFYEQVDRDHN
Ga0207428_107055171	3300027907	Populus Rhizosphere	MKTILSALVALSVMAGVAGSASALDAKTFFEQVDRDHN
Ga0207428_107931391	3300027907	Populus Rhizosphere	MKTILSALVALSVIAGVAGAAVAMDAKEFYERVDRNHF
Ga0207428_112333431	3300027907	Populus Rhizosphere	MKTITSAFVALLVIAGAVGTAKAFDAKIFYEQVDRNRN
Ga0209382_102241472	3300027909	Populus Rhizosphere	MKTILSALVALSVIAGVAGSASALDAKTFFEQIDRDHN
Ga0209698_110818261	3300027911	Watersheds	MKTILSALIALSVIAGVATSASALDAKTFYAQQDAAHN
Ga0268264_124214822	3300028381	Switchgrass Rhizosphere	MIMKTILSALVALSVIASVAGTANALDAKSFFEQVDRDHN
Ga0268264_126183561	3300028381	Switchgrass Rhizosphere	MIMKIILSALVALSVIASVAGSASALDAKTFFEQIDRDHN
Ga0268264_126183562	3300028381	Switchgrass Rhizosphere	TILSALVALLVIAGVAGTASAMDAKTFYEQVDRNHY
Ga0307499_100062943	3300031184	Soil	MKTILSALLALSVLAGFAGTAAADVDAKTFYEKVDRDRF
Ga0307499_100318382	3300031184	Soil	MKTILSALVVLSIIAGVANSASAFDAKDFYEQVDRNHN
Ga0307499_100662593	3300031184	Soil	MKTILSAIVALSVIAGVAGSASALDAKTFYEQVDRDHN
Ga0307499_100662594	3300031184	Soil	MKTILSALVALSVIAGVAGAASALDAKTFYEQVDRNHY
Ga0307499_100784601	3300031184	Soil	MKTILSALVALSVIASVAGTANALDAKTFFEQVDRDHN
Ga0307499_101596191	3300031184	Soil	MKTVWSVLIALSIIAGVAGTASADFDTKTFWEDLSRSAQ
Ga0307499_101716251	3300031184	Soil	MKTVWSVLIALSIIAGVAGTASAEFDTKTFWEDLSRSAR
Ga0307499_101952131	3300031184	Soil	MNGEIAMKTITSALVALLLIAGVAGTGQAFDAKTFYEQVDRNHN
Ga0307500_102079951	3300031198	Soil	MKTIVSALVALSVIAGVAGTASALDAKTFFEQVDRDHN
Ga0307500_102509791	3300031198	Soil	MKTILSAIVALSVIASVAGPANALDAKTFFEQVDRDHN
Ga0307500_102777761	3300031198	Soil	MAMKTITSALVALLFIAGVAGTAQAFDAKTFYEQVDRNHN
Ga0310886_102338142	3300031562	Soil	MKTVLSALVALSVIAGIAGSANALDAKTFYEQVDRSHYAKKD
Ga0247727_1000077751	3300031576	Biofilm	MKTIVSALIALSVIAGVATSASAFDAKTFYEQQDRAHN
Ga0247727_1000077752	3300031576	Biofilm	MKTIVSALLALSVIAGVAAPASALDAKTFFEQIDKSHY
Ga0247727_1000077753	3300031576	Biofilm	MKTIVAALLALSVIAGVATSASAFDAKTFYEQLDKNHY
Ga0247727_101852611	3300031576	Biofilm	PNRREAMKTIVSALVALSVIAGVAAPASAFDSKSFFEQQTRNLP
Ga0307480_10080491	3300031677	Hardwood Forest Soil	MKTILSALVALSVIAGVAGSASALDAKTFYEQVDRNHY
Ga0307480_10080492	3300031677	Hardwood Forest Soil	MKTIVSALIALSVLAGVAGTVQAFDAKTFYDQVDRDHN
Ga0307480_10089591	3300031677	Hardwood Forest Soil	EPRKTGETAMKTILSALVALSVIAGIAGTASALDAKTFYEQVDRDHY
Ga0307480_10089592	3300031677	Hardwood Forest Soil	MKTILSALVALSVLAGVAGSASAFDAKSFYEQVDRNHY
Ga0307480_10089593	3300031677	Hardwood Forest Soil	MKTILSALVALSVIAGVAGSASALDAKTFFEQVDRDHN
Ga0307480_10242661	3300031677	Hardwood Forest Soil	RMIMKTILSALIVLSVIASVAGSASALDAKTFYEQVDSNHF
Ga0307480_10242662	3300031677	Hardwood Forest Soil	MKTILSALIALSVIASVAGSASALDAKTFYEQVDRDHN
Ga0307469_100688432	3300031720	Hardwood Forest Soil	MKTITSALVALLVIAGAAGTAQALDAKTFYEQVDRNHN
Ga0307469_103914771	3300031720	Hardwood Forest Soil	MQTITSALVALVLLTGIAGSAQALDARSFYEQVDRNHN
Ga0307469_105948221	3300031720	Hardwood Forest Soil	MKTITSALVALLAIAGVSGTASAFDAKTFYEQVDRNHN
Ga0307469_106608572	3300031720	Hardwood Forest Soil	MKTILSAIVALSVIAGIASSASALDAKTFYEQIDRDHN
Ga0307469_107977502	3300031720	Hardwood Forest Soil	MNTTMSALVALLVIAGVAGSANAFDAKTFYEQVDRDRN
Ga0307469_113354221	3300031720	Hardwood Forest Soil	MRTITSALVALLVIAGVSGTASAFDAKTFYEQVDRNHN
Ga0307469_119571541	3300031720	Hardwood Forest Soil	QLVNRPHQRRMIMKIILAALVALSVIASVAGSASALDAKTFFEQIDRDHN
Ga0307468_1000098592	3300031740	Hardwood Forest Soil	MKTILSTLVALSVIAGVAGTASALDAKTFFEQIDRDHN
Ga0307468_1000424993	3300031740	Hardwood Forest Soil	MKTITSALVALLVIAGITGTANAFDAKTFYEQIDRDHN
Ga0307468_1000464601	3300031740	Hardwood Forest Soil	MKTILSALVALSVIAGVAGTASALDAKTFFEQVDRDHN
Ga0307468_1002549562	3300031740	Hardwood Forest Soil	MKAILSALLALSVIAGVAGSASALDAKTFYEQVDRNHF
Ga0307468_1002549563	3300031740	Hardwood Forest Soil	MKTILSALIALSVIAGVAGSASALDAKTFYEQVDRNHF
Ga0307468_1002622924	3300031740	Hardwood Forest Soil	MKTILSALVALSVLAGVAGSASALDAKTFYEQVDRDHN
Ga0307473_105881682	3300031820	Hardwood Forest Soil	MKTITSALLALLVIAAVAGAAEALDAKTFYEQVDRDHN
Ga0310900_102267621	3300031908	Soil	MKTILSALLALSVLAGFAGTAAADVDAKTFYETVDRDRF
Ga0310900_104663802	3300031908	Soil	MKTITSALVALVLLTGITGSAKALDARSFYDQVDRNHN
Ga0310900_105124893	3300031908	Soil	MKTILSALVALSVIAGVAGAASALDAKTFYEQVDRDHN
Ga0310900_112126792	3300031908	Soil	MKTITSALVALLLIAGVAGTAQAFDAKTFYEQLDRNHN
Ga0310900_115340902	3300031908	Soil	TGETIMKTITSALVALVLLTGIAGSAQALDARSFYEQVDRNHN
Ga0214473_122100292	3300031949	Soil	MKTILSALIALSALAGIAASASAADLDAKTYFEQMDRSRY
Ga0306926_124934612	3300031954	Soil	MKTILSALIALSVLVGIAGSAAAFDAKTFYEQQGRSHY
Ga0310902_108346782	3300032012	Soil	MKTITSALVALLLIAGVAGTAQAFDAKTFYEQADRNHN
Ga0307470_100333143	3300032174	Hardwood Forest Soil	MKTILSALLALSVLAGFAGAAAANVDAKTFYEQVDRDRF
Ga0307470_101587162	3300032174	Hardwood Forest Soil	MAMKTITSALVALLVIAGVAGVAQAFDAKAFYERVDRSHN
Ga0307470_102041402	3300032174	Hardwood Forest Soil	MKTITSALVALLVIAGITGTANAFDAKTFYEQIDRDPN
Ga0307470_107259064	3300032174	Hardwood Forest Soil	EIMKTILSALIALSVIAGVAGSASALDAKTFYEQVDRNHF
Ga0307470_109079352	3300032174	Hardwood Forest Soil	VKTILSALVALSVIAGVAGGAVAMDAKEFYERVDRNHF
Ga0307470_109262271	3300032174	Hardwood Forest Soil	NTKKRRMIMKTILSALIALSVIASVAGSASAFDAKTFYEQVDRDHN
Ga0310889_106579583	3300032179	Soil	YQKRRMIMKTMLSALIALSVIAGVAGSASALDAKTFYEQVDRNHY
Ga0307471_1001395543	3300032180	Hardwood Forest Soil	MKTILSAIVALSVIAGVASSASALDAKTFYEQIDRDHN
Ga0307471_1004356723	3300032180	Hardwood Forest Soil	MKTILSALIALSVIAGVAGSASALDAKTFYEQVDSNHF
Ga0307471_1004356724	3300032180	Hardwood Forest Soil	MKTILSAVVALSVIAGVAGSASALDAKTFYEQVDRNHY
Ga0307471_1009123211	3300032180	Hardwood Forest Soil	QRRMIMKIILAALVALSVIASVAGSASALDAKTFFEQIDRDHN
Ga0307472_1004549082	3300032205	Hardwood Forest Soil	MKTILSALVALSVIAGVAGSASAFDAKTFYEQVDRDHN
Ga0307472_1009131754	3300032205	Hardwood Forest Soil	AMKTILSALVALSVIAGVAGSASALDAKTFYEQVDRNHY
Ga0307472_1015425241	3300032205	Hardwood Forest Soil	MKTILSALVALSVIAGVAGTASALDAKTFFEQIDRDHN
Ga0307472_1017947691	3300032205	Hardwood Forest Soil	MKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHNSRADPRPGRPAR
Ga0314862_0188364_401_511	3300033803	Peatland	MKILVSAILALSVLAGAAASASALDAKTFYEQQDRSH
Ga0314781_078459_466_585	3300034660	Soil	MKTILSALTALSVLAGFAGNAAANVDAKSFYEQVDRDRF
Ga0314782_161934_171_293	3300034661	Soil	MIMKTILSALVALSVIVSVAGPANALDAKTFFEQVDRDHN
Ga0314782_161934_343_465	3300034661	Soil	MIMKTILSALVALSVIAGVAGGAVAMDAKEFYERVDRNHF
Ga0314794_082409_11_133	3300034669	Soil	MIMKTILSTLVALSVLAGVAGSASALDAKTFYEQVDRNHY
Ga0314795_063650_232_354	3300034670	Soil	MIMKTILSARVALSVIAGVAGAASALDAKTFYEQVDRDHN
Ga0314795_126782_14_136	3300034670	Soil	MIMKTIVSALIALSVIAGVAGSASALDAKTFYEQVDRNHY
Ga0314795_126782_173_295	3300034670	Soil	MIMKTIVSALIALSVLAGVAGTVQAFDAKTFYDQVDRDHN
Ga0314796_172417_383_505	3300034671	Soil	MIMNPTLASFVALWFIAGVPGAASALDAKTFYEQVDRNHY
Ga0314797_132480_42_158	3300034672	Soil	LTTILTAFVAFGFRAGVAGPASALDAKTFYEQVDRNHY
Ga0373948_0031554_567_683	3300034817	Rhizosphere Soil	MKTILSALLAHSVIASVVGPANALDAKTFFEQVDRDHN
Ga0373948_0151482_347_463	3300034817	Rhizosphere Soil	MKTILSALVALSVIVSVAGPANALDAKTFFEQVDRDHN
Ga0373950_0025762_591_713	3300034818	Rhizosphere Soil	MIMKTILSALVALSVIASVAGPANALDAKTFFEQVDRDHN
Ga0373950_0117692_5_121	3300034818	Rhizosphere Soil	MQTITSALIALLLVAGLASTAQALDAKTFYGEVDRNRN
Ga0373958_0150531_408_524	3300034819	Rhizosphere Soil	MKTITSALLALLVIAAVAGAAEALDAKTFYEQVDRNHN
Ga0373958_0197503_49_183	3300034819	Rhizosphere Soil	MTGDVAMQTITSALIALLLVAGLAGAAQALDAKTFYGEVDRNRN
Ga0373959_0142653_237_371	3300034820	Rhizosphere Soil	MTGDVAMQTITSALIALLLVAGLAGAAQALDAKTFYGEVDRNHN

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F002340

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Geographical Distribution

Zoom:	Powered by OpenStreetMap