Basic Information | |
---|---|
IMG/M Taxon OID | 7000000740 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053334 | Ga0030600 |
Sample Name | Human stool microbial communities from NIH, USA - visit 2, subject 763840445 |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 185734961 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Hungatella → Hungatella hathewayi | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | National Institutes of Health, USA | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029444 | Metagenome | 188 | Y |
F067720 | Metagenome | 125 | Y |
F074899 | Metagenome / Metatranscriptome | 119 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
C2456801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 620 | Open in IMG/M |
SRS064276_LANL_scaffold_48678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Hungatella → Hungatella hathewayi | 6461 | Open in IMG/M |
SRS064276_LANL_scaffold_54962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 4271 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
C2456801 | C2456801__gene_235793 | F067720 | MASTTYRHLGDVTEMYAAQEQFRDLTKTYHLGNVPVMVRNAGQLPQPFWLGAACGGG |
SRS064276_LANL_scaffold_48678 | SRS064276_LANL_scaffold_48678__gene_101625 | F074899 | MSGRKQWNKQAATSSFLDKKPPESLILQGLEGSTTLGKDEVGS |
SRS064276_LANL_scaffold_54962 | SRS064276_LANL_scaffold_54962__gene_115645 | F029444 | MEVSEQLTGFELEYLMSWTVSNLQRPFREDFSLQKSGIIAEKESQIFGRRFVGFDS |
⦗Top⦘ |