7000000696: Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159611913

Overview

Basic Information

• IMG/M Taxon OID: 7000000696
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0053281 | Ga0031319
• Sample Name: Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159611913
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 64958820
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: National Institutes of Health, USA
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051211	Metagenome	144	N
F067847	Metagenome	125	N

Associated Scaffolds

Scaffold	Taxonomy	Length
C2313719	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	514
SRS024637_LANL_scaffold_590	All Organisms → cellular organisms → Bacteria	2341

Sequences

Scaffold ID	Protein ID	Family	Sequence
C2313719	C2313719__gene_82769	F067847	MFSHIIRVKGIFDDEPTTKKLYFHMSRREMFDFIKRYDNVTNFEKWLQAAIDNEDLYTMMKFFDDLIGTSYGERQGERFVKSEQIKESFLNSPEYEELFDQLMDNPALVREFYNGILPEK
SRS024637_LANL_scaffold_590	SRS024637_LANL_scaffold_590__gene_631	F051211	MRVKKAIKVFEKIRDLPYGTSGSNEVWSCYQKCVLLKQELQHIGITSQLLIGVFDWQDLQIPEHILKICRQQYERHVILRVFIDEFAYDVDPSIDIGLTPMLPMACWDGKSSTTTMAPLRYLRVYRPHSLHERILSQLRRKIFRSNPESFYTAIDIWLATIRVS