7000000690: Human stool microbial communities from NIH, USA - visit 2, subject 638754422

Overview

Basic Information

• IMG/M Taxon OID: 7000000690
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0053267 | Ga0030592
• Sample Name: Human stool microbial communities from NIH, USA - visit 2, subject 638754422
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 103702644
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: National Institutes of Health, USA
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042936	Metagenome	157	N

Associated Scaffolds

Scaffold	Taxonomy	Length
C1592282	Not Available	933

Sequences

Scaffold ID	Protein ID	Family	Sequence
C1592282	C1592282__gene_126914	F042936	MGRGGGKGRVWKTKEGIMKTSGIVDRGEDTIRNFEKVEQEGALTPPYLRKVYFRSRLRGK