NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000644

7000000644: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 764062976



Overview

Basic Information
IMG/M Taxon OID7000000644 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053220 | Ga0028031
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 2, subject 764062976
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size23033807
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationNational Institutes of Health, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051213Metagenome144N
F077404Metagenome117N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
SRS063272_LANL_scaffold_10461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales4846Open in IMG/M
SRS063272_LANL_scaffold_8240All Organisms → cellular organisms → Bacteria8582Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
SRS063272_LANL_scaffold_10461SRS063272_LANL_scaffold_10461__gene_11794F051213MKASKFLWAVVIALTFVLTSCDPFSKNEPIVEGDVDKYFDSNAQHKSFRVLTAEGKPYNHKVDWHIVGIMVPYSDTYLTKKVDTLSNGDFRISYDWVTFTIKENKSVIDVEVQKNETGKERSVTFRPSNSYKQAYLPKIRVTQRAK
SRS063272_LANL_scaffold_10461SRS063272_LANL_scaffold_10461__gene_11795F051213MKVSKFLWAVVMALTFVLTSCDPFSQNEPTIEGDHYKYFDSSVQRQSFRVVNGSGKQYNHKVDWHIIGIREENSDTYLTKKVDTLSNGDFRISYDWVTFTVKKNKSVIDVEVQKNETGKDRSVFFATRNSYKQAYLPNMIVTQRAK
SRS063272_LANL_scaffold_8240SRS063272_LANL_scaffold_8240__gene_7962F077404MNILKTAFAFFFALCFMMGANSYAQKTESINAEASKRELKRNAVYLPPALEEYTDTILLHQRFIVENKGNYLYTPFTKDNEPSIPFNYGFLHPLGERFYNSFMGKVDRILRPKEDKGFIILTNYLVVLDDKYAFDTSNKDTSKLADLKYLDFRRIKSDFSYGHPYQGFTDYDRVELSYFVQSYGRQAALETANTWVMASYPFSLQSTKFENLYTRGRKLILTDGKTTLSLYFLMIDSVALNFDTKVLPYIKGVFHFNRIQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.