NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000626

7000000626: Human stool microbial communities from NIH, USA - visit 2, subject 764042746



Overview

Basic Information
IMG/M Taxon OID7000000626 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053201 | Ga0030601
Sample NameHuman stool microbial communities from NIH, USA - visit 2, subject 764042746
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size89637381
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationNational Institutes of Health, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076189Metagenome118N
F099406Metagenome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C1821644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales554Open in IMG/M
SRS064557_LANL_scaffold_2806Not Available3691Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C1821644C1821644__gene_106559F076189FAFFLSPFIKPLLYVEKLQIGTVLPVVSDLYREFAELSAHFDLYAIQSAQKQLRMLCNFHENTFGLLIFYTNYAIL
SRS064557_LANL_scaffold_2806SRS064557_LANL_scaffold_2806__gene_3797F099406MAEIGYNSKFEGQEVDSRLENVVQAAPGTGSESGKGGLIPAPPAGSQDGSKTLLSNMTWGDHVTKQYIDDAVSAAGWKKQIVSKLPTVEEAKDNVMYLVKDDVASTETKNVYNEYILVTEEGGTKVLESLGMVSTGVDSSYLDLSIFPSTSGTLDEDSYAKILNAYNNNITLGKLSFYYFSLDYFLDNDNSELKIIAVLFNNTNSKEDVSGSYIDIEMATYVVSQDKTYRAIANTATLSNDMLFYLKFMAKTPNVVTTLASLPIDAHNIIANVASATNLSMAVSAEDVGREWQVRVNNTTGTDITQPLPTYGLFQSMSGDSVVVPKNSFIELSIWYINDKLVIRVGEQA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.