7000000577: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 158499257

Overview

Basic Information

• IMG/M Taxon OID: 7000000577
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0053142 | Ga0027988
• Sample Name: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 158499257
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 28171349
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae	1
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045567	Metagenome	152	N
F047508	Metagenome	149	N

Associated Scaffolds

Scaffold	Taxonomy	Length
C2194339	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae	1000
C2194903	All Organisms → cellular organisms → Bacteria	1036

Sequences

Scaffold ID	Protein ID	Family	Sequence
C2194339	C2194339__gene_54960	F045567	MVTEDVVHTSTHRVEDALLAVDGDILTPRDGTHIVQTERVVVVLVSQEDSIDTIDTETCGLVVEVRATVDEDTLPALGDDEGRGAQTTVTSIRAMAHRAATAYLGDTSAGARTEKNYLHVSRRESYHGK
C2194903	C2194903__gene_55361	F047508	MLGHRLVEGCVKYPYLRRIGEYLRHSFDTEDVGWVVKRSKLCALMEHIYYLWGDTYALSKALCTVYEAVTNGIDLIEGLYEVLFFKNVEDNLYAACVVRNVKVALNLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELDEGELQGGAATVEDQDFHKVLYYMVRCELILSSP