NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000571

7000000571: Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160582958



Overview

Basic Information
IMG/M Taxon OID7000000571 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053136 | Ga0031271
Sample NameHuman tongue dorsum microbial communities from NIH, USA - visit 1, subject 160582958
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size57097122
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092230Metagenome107N
F105378Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C3322047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae630Open in IMG/M
SRS017713_Baylor_scaffold_31730Not Available43439Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C3322047C3322047__gene_91421F092230SEWGAKLKNIYGTDFINKEIIVRDNAVRVDDIRCLYAVNQNEDGLSIYLLLPGGDYLTHNYVGSSFVRFSNSSEYNNMAYGEGSVEVSDSTSTGEVQNTEEKEARDKVDEAINSMRHLFASAIMVNLRVVELYKILTVCMILIVIAMTVGYYSYLKPETVYEFYCKLRRKEKYPSDVNLVKRIGFLAIILPPCMLFLLIL
SRS017713_Baylor_scaffold_31730SRS017713_Baylor_scaffold_31730__gene_35135F105378MKVSVYVDKLKKWVPISSDEVLDRNKNLSDVKDKDAAITNLGLYDKFISKEALQSGFLPDVFTPENIVTDADHQFVSDSDKNNWNNKLNKPVEMQTNLEENQIGYDEVNEKFYIGLNNKNVLVGGASALDNIKIVNGFFSGNSQPTIIRNTKTKEDGTLISPIFVDVQCVEYTGGDLGEVSVSYTSELINIYNTGSFTGAFQCMIVYPLGSVNR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.