7000000558: Human attached/keratinized gingiva microbial communities from NIH, USA - visit 2, subject 763496533

Overview

Basic Information

• IMG/M Taxon OID: 7000000558
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0053117 | Ga0027599
• Sample Name: Human attached/keratinized gingiva microbial communities from NIH, USA - visit 2, subject 763496533
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 47415560
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Capnocytophaga	1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Attached/Keratinized Gingiva → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061926	Metagenome	131	N
F089056	Metagenome	109	N
F097490	Metagenome	104	N

Associated Scaffolds

Scaffold	Taxonomy	Length
C596297	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	609
C604145	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Capnocytophaga	842
C620408	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	3099

Sequences

Scaffold ID	Protein ID	Family	Sequence
C596297	C596297__gene_50777	F097490	LLCIISCSERKEIEVYNMKIDENKKEVLVEIRNNTENNYYLLSPIVSIMTKHLQYIGGEMIEGQIHHKKLDSIVCSVCIWDDICKEEYYAMRDIVLLPKKSVKKIKYKYDNEEYIEIETVHIGFPYNGYYNEIGKKMQFMLKKKLDSSNIIKGYEFYNKDIETMTIKM
C604145	C604145__gene_53220	F089056	LLCIISCSKRKEADNTMVLEKNHAFFLWNNDSLGCKHERTIEMGEELYNTFKKSNKNDSILLKEYLGTPTRRFKDKEVIIFMYYINSCCDNGQLLEECDVSFISITFTNKNKILFGKGIQ
C620408	C620408__gene_58537	F061926	MIKTAKHIKTFLASVLLLIFVMNVSGLFVRLHHQETHQKTEKIAECSDKVCYHKAHLQTKSDCDCGFLCTLNYFYILPEKPLTEIHVNEYFSYFSSYKIFVSERIILLWQSRAPPVLS