NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000540

7000000540: Human stool microbial communities from NIH, USA - visit 1, subject 246515023



Overview

Basic Information
IMG/M Taxon OID7000000540 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053098 | Ga0030551
Sample NameHuman stool microbial communities from NIH, USA - visit 1, subject 246515023
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size52642027
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080163Metagenome115N
F092228Metagenome107N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C1084104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae813Open in IMG/M
SRS023346_LANL_scaffold_3627All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae862Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C1084104C1084104__gene_55154F092228TDSYFNNSYLSYNDGTLAAADYRKTKVTAYDSKNNSTVNLPSNGCLINDNLFYINGNKLCCLDTTTNTRKIIDTDCRSFVCNNEVIAYTKNDSVILKNSDTLENIGDIKFDNQIYYINISDGNLYTAERIFEDKTDEYGYSFKVVKQYIFKKYDLKSCKLLKSKNANYVNEIRYVTVCQDTFWFFCDETQTVNNVCLDKDVNYPTIQHPDVKFITSNSDCVYYISEKTESAIILKTVESPYNGIWKLKVGSNKPVKIADKCDCDELLATK
SRS023346_LANL_scaffold_3627SRS023346_LANL_scaffold_3627__gene_7890F080163MKTIKFLQESFETKERFQQEISFKYSYNRDTVESIDFRINQRNIRYFYEAMQNFENSLVNEFKEKKNNLCDAKQFLESINDFDKILFVIITYMKTYFDFCKNYSKISLHVHLVQFDFTMSVLIQGFYNYTHRDLNFSTKLESEILDSEIELLQEKLDLIREELCKIMGIDLNLEKQGHEDNYVFNLNIDSDNQIGFFLQETEL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.