NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000506

7000000506: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 158256496



Overview

Basic Information
IMG/M Taxon OID7000000506 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053058 | Ga0027985
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 2, subject 158256496
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size9894940
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043991Metagenome155N
F081510Metagenome114N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C945381All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes732Open in IMG/M
C950787All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes5473Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C945381C945381__gene_16280F043991MSKKTPSVIDYFSLNGDVVEEANEFDGISLEDWIDKRSSIKPSWVGQYSQQMHFDLPDDTEVSFYKTLNVIYADILFTGGVRTILFKCRQKKNLTRFISRVLELANLG
C950787C950787__gene_19384F081510MKLPKLPNMQTIKSTAKSAMVTTKILGKKYAPFVLLGVGLVGYGYSVYAGVKSGKKLEVTKAKYEAKDAAGEEYTRMEVVKDVAKDVAIPVAVATASTAAIVLGFAIQTNRLKAVSSALAIVTEEHARYRLRAKEVLDEATFKKIDAPLETKTVELDGQEVEVESIVPNEGDFYGQWFKYSSNYVSDDPDYNESYIKEAETYLVNRMMKKGVLTFGEVLDKLGFDVPRAALPFGWTDTDDFYIEWDAHEVFDDVKQEYDLQFYVRWKTPRNLYATTSFKDFVPKKTRKELN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.