| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000431 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052981 | Ga0030466 |
| Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 159369152 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 60990505 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → unclassified Subdoligranulum → Subdoligranulum sp. APC924/74 | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068811 | Metagenome | 124 | N |
| F071325 | Metagenome | 122 | N |
| F088921 | Metagenome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SRS013158_Baylor_scaffold_11693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → unclassified Subdoligranulum → Subdoligranulum sp. APC924/74 | 658 | Open in IMG/M |
| SRS013158_Baylor_scaffold_14840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1226 | Open in IMG/M |
| SRS013158_Baylor_scaffold_4477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → unclassified Subdoligranulum → Subdoligranulum sp. APC924/74 | 1260 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SRS013158_Baylor_scaffold_11693 | SRS013158_Baylor_scaffold_11693__gene_31312 | F071325 | YCSIFKVLLALLSDSSIIISKVVLFVKHFFDIFLSFPNAFLKAFHLHAVRFPAAFLLVHRFYLAFEELLSCATAYL |
| SRS013158_Baylor_scaffold_14840 | SRS013158_Baylor_scaffold_14840__gene_41817 | F068811 | MDQDGSEHNICSNREGLCPGKEQHGASGWKKIFQHGKEPLRNKDSVSQYCNKKAAVSLILNKNVSETLCIFSIDKTNCCRI |
| SRS013158_Baylor_scaffold_4477 | SRS013158_Baylor_scaffold_4477__gene_10947 | F088921 | AGKNHFLYSEKSKSIVFDLDRETKKRKYAKETCRIYIEKDQNMQEEKKEKYINGEIYGEKNQIIVTNKLAMIRDKMRSK |
| ⦗Top⦘ |