Basic Information | |
---|---|
IMG/M Taxon OID | 7000000385 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052930 | Ga0030513 |
Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 160319967 |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 111602286 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067844 | Metagenome | 125 | N |
F068811 | Metagenome | 124 | N |
F076189 | Metagenome | 118 | N |
F105374 | Metagenome | 100 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
C1799843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1138 | Open in IMG/M |
C1820514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1929 | Open in IMG/M |
SRS017433_Baylor_scaffold_17275 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 5097 | Open in IMG/M |
SRS017433_Baylor_scaffold_19090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1401 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
C1799843 | C1799843__gene_124171 | F068811 | MDQDGSEHNICSNREGLCPGKEQHGASGWKKIFQHGKEPLRNKDSVSQYCNKKVAVLLILNENVSETLCIFSIDKTNCCRIK |
C1820514 | C1820514__gene_134607 | F076189 | MPGRLCYLPGIAFFLSPFIKPLLYVEKLQIGTVLPVVSDLYREFAELSAYFDLYAIQSAQKQLRMLCNFHENTFGLLIFYTNYAIL |
SRS017433_Baylor_scaffold_17275 | SRS017433_Baylor_scaffold_17275__gene_43069 | F105374 | LRPGFGAAENIRYLVLSKGVFAMKKRVALLVALCIWKVVAAQTPYGEMPELFRPDTLPCRLGGGVCFGMDGLDAAIPRGEGASSCRDPRVVFVAGDTLITFISVAGVANTALGDPVCRFYGRNVARVVSRTRRMTGGRMGAADNDFPDDPDFAELQGVVIENQRYPWESYAAGDSAYRLPVARSLVGGKEDPLLGSDMRRRYVRLLTEVSVELKAGGTRPFVHVVYLLPDP |
SRS017433_Baylor_scaffold_19090 | SRS017433_Baylor_scaffold_19090__gene_49960 | F067844 | MNTLAAETASAWYLILNRKLQTLPIYITQLSSHLPRPLTMGTQQVSAGAAVITPQHRSYRVPQGSPQVF |
⦗Top⦘ |