| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000353 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052892 | Ga0031073 |
| Sample Name | Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158337416 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 58178020 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Providencia → Providencia rettgeri | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018385 | Metagenome | 235 | Y |
| F051211 | Metagenome | 144 | N |
| F057446 | Metagenome | 136 | N |
| F058221 | Metagenome | 135 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C1890092 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 537 | Open in IMG/M |
| C1892730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Providencia → Providencia rettgeri | 553 | Open in IMG/M |
| C1923732 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 990 | Open in IMG/M |
| SRS022083_Baylor_scaffold_19611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1180 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C1890092 | C1890092__gene_86041 | F058221 | MGKIKNFQDLKNQKEELRAEIKEIESVLSFENPRKSFGVITNGVTEKYLGGMMDSSLAQNAFFLADKFLFPSLEIGSAKLLSNALLKKVRPSMKKTLIGLGVAVLTPIVIMQIKKRLDDFQQRETAKSLSKLI |
| C1892730 | C1892730__gene_87232 | F051211 | MRVKKAIRIFEKIRDLPYGTSGSDEVWSCYRKCVLLKQELQHIGITSQLLIGVFDWQDLPTPEHTLNLRRQRHERHVILRVFIDGSTYDIDPSIDIGLAPTLPIAHWDGASSTATMASLKHLRVYRPHSLYERILSR |
| C1923732 | C1923732__gene_100878 | F057446 | MNSISFGKTTITSYPEYFEITDNKKTSKLLYLSASFVFIVIYLFDLYQNDFDFGKVAHFKTISAMLWLVIFALQFWLINTESKIEKSKIKEIVVRKNRWASIVIHYGDKKRKIDGFSQDEAEQIIKFLMNNR |
| SRS022083_Baylor_scaffold_19611 | SRS022083_Baylor_scaffold_19611__gene_26529 | F018385 | MSEYVNQWESYKELSIENDRDPVLDDPIIYGVNVKHFTLTVYSPEGRVSKYWNARILQDQLGRCRIACPRDGKILCFAWFEWTSYMFSHDGLNELVFMPRTNSRLPSTLWNTKEVK |
| ⦗Top⦘ |