NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000353

7000000353: Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158337416



Overview

Basic Information
IMG/M Taxon OID7000000353 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052892 | Ga0031073
Sample NameHuman supragingival plaque microbial communities from NIH, USA - visit 2, subject 158337416
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size58178020
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Providencia → Providencia rettgeri1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018385Metagenome235Y
F051211Metagenome144N
F057446Metagenome136N
F058221Metagenome135N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C1890092All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales537Open in IMG/M
C1892730All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Providencia → Providencia rettgeri553Open in IMG/M
C1923732All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae990Open in IMG/M
SRS022083_Baylor_scaffold_19611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1180Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C1890092C1890092__gene_86041F058221MGKIKNFQDLKNQKEELRAEIKEIESVLSFENPRKSFGVITNGVTEKYLGGMMDSSLAQNAFFLADKFLFPSLEIGSAKLLSNALLKKVRPSMKKTLIGLGVAVLTPIVIMQIKKRLDDFQQRETAKSLSKLI
C1892730C1892730__gene_87232F051211MRVKKAIRIFEKIRDLPYGTSGSDEVWSCYRKCVLLKQELQHIGITSQLLIGVFDWQDLPTPEHTLNLRRQRHERHVILRVFIDGSTYDIDPSIDIGLAPTLPIAHWDGASSTATMASLKHLRVYRPHSLYERILSR
C1923732C1923732__gene_100878F057446MNSISFGKTTITSYPEYFEITDNKKTSKLLYLSASFVFIVIYLFDLYQNDFDFGKVAHFKTISAMLWLVIFALQFWLINTESKIEKSKIKEIVVRKNRWASIVIHYGDKKRKIDGFSQDEAEQIIKFLMNNR
SRS022083_Baylor_scaffold_19611SRS022083_Baylor_scaffold_19611__gene_26529F018385MSEYVNQWESYKELSIENDRDPVLDDPIIYGVNVKHFTLTVYSPEGRVSKYWNARILQDQLGRCRIACPRDGKILCFAWFEWTSYMFSHDGLNELVFMPRTNSRLPSTLWNTKEVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.