NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000264

7000000264: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 370425937



Overview

Basic Information
IMG/M Taxon OID7000000264 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052782 | Ga0028024
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 2, subject 370425937
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size30752515
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas catoniae → Porphyromonas catoniae ATCC 512701

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043235Metagenome156N
F047508Metagenome149N
F051213Metagenome144N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
SRS052668_LANL_scaffold_11121All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales740Open in IMG/M
SRS052668_LANL_scaffold_23796All Organisms → Viruses → Predicted Viral2648Open in IMG/M
SRS052668_LANL_scaffold_8671All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas catoniae → Porphyromonas catoniae ATCC 51270731Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
SRS052668_LANL_scaffold_11121SRS052668_LANL_scaffold_11121__gene_20302F043235LCDDDPRRLCSGLGIVTRYPEGAIALFIGLAHRDQCDIDRIDTIPKEVWEFMEVTREIVDSLIQVSGAAILVKEVKDGMYMPHHLWAEVPRLGKVQHVEGFHVREALAIIVEGFGEAAGGCHSMAKDQEVPALYCRSHGFEGGRSMASNVLLPGSAH
SRS052668_LANL_scaffold_23796SRS052668_LANL_scaffold_23796__gene_43588F051213MALTFVLTSCDPFSQNEPTIEGDRYKYFDSSAQRQSFRVVNGSGKQYNHKVDWHIIGILEENSSTYLTKKVDTLSNGDFRISYDWVTFTVKENKSVIDVEVQKNETGKDRSVFFATSNSYKQAYLPNMIVTQRAK
SRS052668_LANL_scaffold_8671SRS052668_LANL_scaffold_8671__gene_15899F047508GEYLRHRFDTEDVGWVVKRSKLCALMEHIYYLWGDTYALSKALCTVYEAVTDGVDLIEGLYEVLFFENVEDNLYAACVVRNVKVALNLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELNEGELQGGAATVEDQDFHKVLYYMVRCELILSSP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.