Basic Information | |
---|---|
IMG/M Taxon OID | 7000000264 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052782 | Ga0028024 |
Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 370425937 |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 30752515 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1 |
All Organisms → Viruses → Predicted Viral | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas catoniae → Porphyromonas catoniae ATCC 51270 | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043235 | Metagenome | 156 | N |
F047508 | Metagenome | 149 | N |
F051213 | Metagenome | 144 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
SRS052668_LANL_scaffold_11121 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 740 | Open in IMG/M |
SRS052668_LANL_scaffold_23796 | All Organisms → Viruses → Predicted Viral | 2648 | Open in IMG/M |
SRS052668_LANL_scaffold_8671 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas catoniae → Porphyromonas catoniae ATCC 51270 | 731 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
SRS052668_LANL_scaffold_11121 | SRS052668_LANL_scaffold_11121__gene_20302 | F043235 | LCDDDPRRLCSGLGIVTRYPEGAIALFIGLAHRDQCDIDRIDTIPKEVWEFMEVTREIVDSLIQVSGAAILVKEVKDGMYMPHHLWAEVPRLGKVQHVEGFHVREALAIIVEGFGEAAGGCHSMAKDQEVPALYCRSHGFEGGRSMASNVLLPGSAH |
SRS052668_LANL_scaffold_23796 | SRS052668_LANL_scaffold_23796__gene_43588 | F051213 | MALTFVLTSCDPFSQNEPTIEGDRYKYFDSSAQRQSFRVVNGSGKQYNHKVDWHIIGILEENSSTYLTKKVDTLSNGDFRISYDWVTFTVKENKSVIDVEVQKNETGKDRSVFFATSNSYKQAYLPNMIVTQRAK |
SRS052668_LANL_scaffold_8671 | SRS052668_LANL_scaffold_8671__gene_15899 | F047508 | GEYLRHRFDTEDVGWVVKRSKLCALMEHIYYLWGDTYALSKALCTVYEAVTDGVDLIEGLYEVLFFENVEDNLYAACVVRNVKVALNLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELNEGELQGGAATVEDQDFHKVLYYMVRCELILSSP |
⦗Top⦘ |