| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000264 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052782 | Ga0028024 |
| Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 370425937 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 30752515 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1 |
| All Organisms → Viruses → Predicted Viral | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas catoniae → Porphyromonas catoniae ATCC 51270 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043235 | Metagenome | 156 | N |
| F047508 | Metagenome | 149 | N |
| F051213 | Metagenome | 144 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SRS052668_LANL_scaffold_11121 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 740 | Open in IMG/M |
| SRS052668_LANL_scaffold_23796 | All Organisms → Viruses → Predicted Viral | 2648 | Open in IMG/M |
| SRS052668_LANL_scaffold_8671 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas catoniae → Porphyromonas catoniae ATCC 51270 | 731 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SRS052668_LANL_scaffold_11121 | SRS052668_LANL_scaffold_11121__gene_20302 | F043235 | LCDDDPRRLCSGLGIVTRYPEGAIALFIGLAHRDQCDIDRIDTIPKEVWEFMEVTREIVDSLIQVSGAAILVKEVKDGMYMPHHLWAEVPRLGKVQHVEGFHVREALAIIVEGFGEAAGGCHSMAKDQEVPALYCRSHGFEGGRSMASNVLLPGSAH |
| SRS052668_LANL_scaffold_23796 | SRS052668_LANL_scaffold_23796__gene_43588 | F051213 | MALTFVLTSCDPFSQNEPTIEGDRYKYFDSSAQRQSFRVVNGSGKQYNHKVDWHIIGILEENSSTYLTKKVDTLSNGDFRISYDWVTFTVKENKSVIDVEVQKNETGKDRSVFFATSNSYKQAYLPNMIVTQRAK |
| SRS052668_LANL_scaffold_8671 | SRS052668_LANL_scaffold_8671__gene_15899 | F047508 | GEYLRHRFDTEDVGWVVKRSKLCALMEHIYYLWGDTYALSKALCTVYEAVTDGVDLIEGLYEVLFFENVEDNLYAACVVRNVKVALNLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELNEGELQGGAATVEDQDFHKVLYYMVRCELILSSP |
| ⦗Top⦘ |