7000000258: Human stool microbial communities from NIH, USA - visit 1, subject 765074482

Overview

Basic Information

• IMG/M Taxon OID: 7000000258
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0052776 | Ga0030501
• Sample Name: Human stool microbial communities from NIH, USA - visit 1, subject 765074482
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 180105671
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae	2
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides salyersiae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042936	Metagenome	157	N
F055775	Metagenome	138	N
F088914	Metagenome	109	N

Associated Scaffolds

Scaffold	Taxonomy	Length
C5110894	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae	572
C5249381	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae	1530
C5269397	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides salyersiae	2198

Sequences

Scaffold ID	Protein ID	Family	Sequence
C5110894	C5110894__gene_193743	F088914	LPVCSGFFVFWSRKEGANYQISVKSFSNLDSYDIIQLYIMTELTDGRVSDRLFSVPYTPKENIKNPGEFIVFSAWYAAKALEMDVK
C5249381	C5249381__gene_260539	F042936	MGRGGGKGRVWKTKEGIMKTSGIVDRGEDTIRNVEKVEQKGALTPPYLGKVYFRSRLRGK
C5269397	C5269397__gene_273205	F055775	LVIEVATTAAALDGDTKKKLIECIEGGTITDVILVTKEVEKKISHARVVSWLVDTTGDSPKYTIDIIDAKSGAVEAIA