NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000242

7000000242: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 550534656



Overview

Basic Information
IMG/M Taxon OID7000000242 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052760 | Ga0028016
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 550534656
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size695879
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043991Metagenome155N
F051214Metagenome144N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C344130All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes653Open in IMG/M
C344150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes682Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C344130C344130__gene_1892F051214MPGKIVAHDTHLRIDTEFIELKDCFEAFRRGVEYRDKNDVDDILVICNAPDIIEYQLKNGDSFIVTYDPIHRIIVMRVFLHDEDITIKPIYIYNNREYQ
C344150C344150__gene_1907F043991MSKKNPSVIDYFDLNGDLNEEAYEFEDVKLEEYIDKRSNVKPSWVGKYSHQMHFDFPDDTEVSFYKGLNIVYADINFAGGIRTILFKCRQKKNLTRFISRVLEIAQGDPSNVHPDFRA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.