7000000237: Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764285508

Overview

Basic Information

• IMG/M Taxon OID: 7000000237
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0052755 | Ga0031250
• Sample Name: Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764285508
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 39521892
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018385	Metagenome	235	Y
F054110	Metagenome	140	N

Associated Scaffolds

Scaffold	Taxonomy	Length
C1276129	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2286
C1279176	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella	32460

Sequences

Scaffold ID	Protein ID	Family	Sequence
C1276129	C1276129__gene_67937	F018385	MMAENVNQWESYKELSIENDRDPVLDDPIIYGVNVKHFTLTVYSPEGRVSKYWNARILQDQLGRCRIACPRDGKILCFAWFEWTSYMFSHDGLNELVFMPRMNSRLPSTLWNTKGAK
C1279176	C1279176__gene_71711	F054110	VLDVNYQPTIKKLLKALQMNGRRYVVDVRQTWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVRTYKGGD