| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000193 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052698 | Ga0030579 |
| Sample Name | Human stool microbial communities from NIH, USA - visit 2, subject 764184357 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 130414053 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → unclassified Subdoligranulum → Subdoligranulum sp. APC924/74 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042936 | Metagenome | 157 | N |
| F074899 | Metagenome / Metatranscriptome | 119 | N |
| F087334 | Metagenome | 110 | N |
| F088920 | Metagenome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C1824032 | Not Available | 663 | Open in IMG/M |
| SRS048870_WUGC_scaffold_15164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 4021 | Open in IMG/M |
| SRS048870_WUGC_scaffold_32330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → unclassified Subdoligranulum → Subdoligranulum sp. APC924/74 | 529 | Open in IMG/M |
| SRS048870_WUGC_scaffold_34231 | Not Available | 542 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C1824032 | C1824032__gene_163821 | F042936 | GGKGRVWKTKEGIMKTSGIVDRGEDTIRNFEKVEQEGALTPPYLGKVYFRSRLRGKG |
| SRS048870_WUGC_scaffold_15164 | SRS048870_WUGC_scaffold_15164__gene_24647 | F074899 | MSGRKQWNKQAATSSFLDKKTPQSLIQQGLESSTVVGKDEVGSSNLPSSSNKTL |
| SRS048870_WUGC_scaffold_32330 | SRS048870_WUGC_scaffold_32330__gene_57057 | F087334 | MASRYPFVAAAAHLFPKNAIKMLSFSTSGKGSILLYPFRSSPLLAITFLYHPKDFFLYRAAALFEYREKHQ |
| SRS048870_WUGC_scaffold_34231 | SRS048870_WUGC_scaffold_34231__gene_61464 | F088920 | FFSFVSANLHHYPAFGAGVILHLILHFSQKVAIFAPKRAFSLLFVPTLFFAGLSVLSPQTSPKISGQTSLYQPWLSPYCLFKD |
| ⦗Top⦘ |