NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000186

7000000186: Human stool microbial communities from NIH, USA - visit 1, subject 809635352



Overview

Basic Information
IMG/M Taxon OID7000000186 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052691 | Ga0030547
Sample NameHuman stool microbial communities from NIH, USA - visit 1, subject 809635352
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size102380872
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii2
Not Available1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076064Metagenome118N
F099451Metagenome103N
F101357Metagenome / Metatranscriptome102N
F105374Metagenome100N
F105375Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C1680183All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii1061Open in IMG/M
SRS022524_Baylor_scaffold_18600Not Available625Open in IMG/M
SRS022524_Baylor_scaffold_23906All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii1326Open in IMG/M
SRS022524_Baylor_scaffold_43724All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes904Open in IMG/M
SRS022524_Baylor_scaffold_44257All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes5786Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C1680183C1680183__gene_200121F105375MKNNETFQTTQHLDKLVTNLGLQIQELFSLDLEEILDYSNNLMNLLVNAYVENQCLALSAMISKQDGFAIYSFLFQTPDTSNGAADALVSFAMNFTDGEANIKSISRISSNIMQITFTV
SRS022524_Baylor_scaffold_18600SRS022524_Baylor_scaffold_18600__gene_42948F099451LRPGEYASGLLIKKIMAIDKIKTVGQLRKVIENLSDDYEIEMRIRRKLSDDEIKELYNKYGRIYPYPYETQYPELEFDDIGVSDKVLCLGVELKDK
SRS022524_Baylor_scaffold_23906SRS022524_Baylor_scaffold_23906__gene_55576F101357MNLNNITTTLKTGITIYQYEQWQNTGSVNLMQKESHMLSKVWLKTNIYNPDSLDKPFIQLSATFTSEFDIQEYNEWLNANQYKLYPLLLDILKISLKDDFYNYSNASNIHYEGGKFPSMLTIQLFNLEF
SRS022524_Baylor_scaffold_43724SRS022524_Baylor_scaffold_43724__gene_102425F076064LKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVMLFTPEAEKLMLAEDYFSARRQIRLCAPDLKRLNETRRHPM
SRS022524_Baylor_scaffold_44257SRS022524_Baylor_scaffold_44257__gene_103713F105374LRPGFGAAENIRYLVLSKGVFAMKKRVALLVALCIWKVVAAQTPYGEMPELFRPDTLPCRLGGGVCFGMDGLDAAIPRGGGASSCRDPRVVFVAGDTLITFISVAGVADTALGDPVCRFYGRNVARVVSRTRRMTGGRMGAADNDFPDDPDFAELQGVVIENQRYPWESYAAGDSAYRLPVVRSLVGGKEDPLLGSDMRRRYVRLLTEVSVELKAGGTRPFVHVVYLLPDP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.