Basic Information | |
---|---|
IMG/M Taxon OID | 7000000181 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052686 | Ga0030522 |
Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 765013792 |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 70820242 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042936 | Metagenome | 157 | N |
F088920 | Metagenome | 109 | Y |
F101355 | Metagenome | 102 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
C1745846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1265 | Open in IMG/M |
C1763543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 5595 | Open in IMG/M |
SRS018656_WUGC_scaffold_12111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3298 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
C1745846 | C1745846__gene_98666 | F088920 | LFVKWNPKNHHFIFLFLAFFSFVSANLHHYPAFWAGLILHLILHFSQKVAIFALKRVILLLFVPTLFFAGLSVFSPQTSSKISGQTSLHQPWLSPYCLFKD |
C1763543 | C1763543__gene_109255 | F042936 | GRGGGKGRVWKTKEGIMKTSGIVDRGEDTIRNFEKVEQEGALTPPYLGKVYFRSRLRGKG |
SRS018656_WUGC_scaffold_12111 | SRS018656_WUGC_scaffold_12111__gene_27857 | F101355 | MAFWFIQWYLPSTQSPQPKGAGAVFPYVLPRCSYFFKSFVTEMSIFICMHKCLAQTGRLRGSSCHIVVAAKRACACTLLWISDRFYKKLLPYVLFSFFKIYLKKIDFFQNIA |
⦗Top⦘ |