NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000101

7000000101: Human retroauricular crease microbial communities from NIH, USA - visit 2, subject 764305738



Overview

Basic Information
IMG/M Taxon OID7000000101 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052577 | Ga0030071
Sample NameHuman retroauricular crease microbial communities from NIH, USA - visit 2, subject 764305738
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21340820
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctHip21

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Skin → Retroauricular Crease → Unclassified → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105380Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
SRS018978_WUGC_scaffold_15496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctHip24255Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
SRS018978_WUGC_scaffold_15496SRS018978_WUGC_scaffold_15496__gene_11082F105380DLTITGLDDEFKMDYYSFWVPDIYLISFKSFNPDGGLYLAYHKKDEKHICLTNIWPDSRNQDDTYFPNGKRLETKSICTGRMMDDIDSAEYSAWKNDPVTRASQYINKFINARGNADLDFVNSTLRRKVPNHNTKKFAEFLGSITKEQENVNTYEEFIEWTKTTEWFK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.