7000000087: Human stool microbial communities from NIH, USA - visit 1, subject 160218816

Overview

Basic Information

• IMG/M Taxon OID: 7000000087
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0052563 | Ga0030520
• Sample Name: Human stool microbial communities from NIH, USA - visit 1, subject 160218816
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 120746708
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088914	Metagenome	109	N
F097493	Metagenome	104	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
C2284261	Not Available	651
C2285507	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	657

Sequences

Scaffold ID	Protein ID	Family	Sequence
C2284261	C2284261__gene_122276	F088914	VGQILPVCSGFFVFWSRKEGVNYQISVKSFSNLDSYDIIQLYIMTELTDGRVSDRLFSVPYTPKENIKNPGKFIVFSAWYAAKALEMDVN
C2285507	C2285507__gene_123054	F097493	MKNGTAQFYEHGVEIDGTVYGIHTDRDTLRIKRSVVNDKFAETDGDFDMDTEIAKIKHTDITFEQPTAEQLEQIQAKTYNSMTELKQHVQSVMNGDETMSQDEINAMLMLQIAELKAGVGGE