Basic Information | |
---|---|
IMG/M Taxon OID | 7000000006 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052470 | Ga0029056 |
Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 737052003 |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 89716939 |
Sequencing Scaffolds | 5 |
Novel Protein Genes | 5 |
Associated Families | 5 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Anaerotruncus → Anaerotruncus colihominis | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → Subdoligranulum variabile | 2 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042936 | Metagenome | 157 | N |
F044554 | Metagenome | 154 | N |
F047126 | Metagenome | 150 | N |
F074899 | Metagenome / Metatranscriptome | 119 | N |
F092227 | Metagenome | 107 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
C1503593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Anaerotruncus → Anaerotruncus colihominis | 983 | Open in IMG/M |
C1539943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 7265 | Open in IMG/M |
SRS054956_LANL_scaffold_12723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → Subdoligranulum variabile | 19265 | Open in IMG/M |
SRS054956_LANL_scaffold_13711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 4912 | Open in IMG/M |
SRS054956_LANL_scaffold_28957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → Subdoligranulum variabile | 16697 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
C1503593 | C1503593__gene_138916 | F074899 | MSGRKQWNKQAATSSFLDKKTPQSLIQQGLEGSTVVGKDEVTS |
C1539943 | C1539943__gene_145458 | F042936 | MGRGGGKGRVWKTKEGIMKTSGIVDRGEGTIRNFEKVEQEGALTPPYLGKVYFRSRLRGK |
SRS054956_LANL_scaffold_12723 | SRS054956_LANL_scaffold_12723__gene_26392 | F044554 | VLAGQFIPVLCASIARLFPCRTEIARCLTLDFSISRYLFLSFSFSFRTNFAQALFSSLLFASDTRAKSILFLLFENEIAHLQGQYRFNSHRYCFSAFLVL |
SRS054956_LANL_scaffold_13711 | SRS054956_LANL_scaffold_13711__gene_28500 | F092227 | GEMNEQKRKRILRVGCLILAGVFLLSVLGSVILMFLV |
SRS054956_LANL_scaffold_28957 | SRS054956_LANL_scaffold_28957__gene_61022 | F047126 | VYLKTKKMTNISQTQAGFKLKSLGILCGFQGFLTQNPAALVETDDIFDVSDTPYGFSGLNTLRAAGVPNPPPPFAQRFIACFCSQTAAASQSKSAYILSSLESSCILCSLLRYFHILSKKLQKTC |
⦗Top⦘ |