| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300034032 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0136120 | Gp0356270 | Ga0334954 |
| Sample Name | Biocrust microbial communities from Mojave Desert, California, United States - 50SNC |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 222548454 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 6 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → environmental samples → uncultured Microcoleus sp. | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil And Biocrust Microbial Communities From Mojave Desert, California, United States |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | desert biome → desert → soil biocrust |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: California | |||||||
| Coordinates | Lat. (o) | 34.3778 | Long. (o) | -117.6098 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003495 | Metagenome / Metatranscriptome | 483 | Y |
| F008145 | Metagenome / Metatranscriptome | 338 | Y |
| F018295 | Metagenome / Metatranscriptome | 236 | Y |
| F027599 | Metagenome / Metatranscriptome | 194 | Y |
| F042189 | Metagenome | 158 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0334954_002857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → environmental samples → uncultured Microcoleus sp. | 2379 | Open in IMG/M |
| Ga0334954_029531 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 835 | Open in IMG/M |
| Ga0334954_053198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 649 | Open in IMG/M |
| Ga0334954_067914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| Ga0334954_079380 | Not Available | 547 | Open in IMG/M |
| Ga0334954_086858 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 526 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0334954_002857 | Ga0334954_002857_2129_2377 | F018295 | MTTSHLIGGNEASDFPKDSEAEADNKIVIDKLLVNKLTELLINSIYSVHVSRRSEIFLTSLDMHLAQDSISNKNDAARRDFTE |
| Ga0334954_029531 | Ga0334954_029531_144_383 | F027599 | VVVAEIEGVLNVVPVPRETPPVDAANQLIVPADAVASSETVPVAHRLSGPVLVIVGMAFIVAITGVLELVVHPFAVASA |
| Ga0334954_053198 | Ga0334954_053198_3_452 | F042189 | VPDLYEVLLVDGGRRWHAGFLVDDETETDVLLRERGKVLLFGSRAALEHHARQHDWQLQDDLPDEIDLDLGGWLSQGMPLPPTAEVSELWHLLYDDPVAGRALGGEALGEAYDDLVEEAPDWFATHGPAARRALADAVQRLRGVLSPPS |
| Ga0334954_067914 | Ga0334954_067914_1_582 | F008145 | EVASSIDAHVREEIDRMVAEIRSSVEDVRAVVDSQLKAALQSVQADVNALTFLPHVRKSIAELEESIAAAQPAPVAAPAASGGSDASRVKRAIQQVERGKAQVDVLNALLDQCLEFGSRAALLILKGETFSGWKGAGFSAHGGNDETIKRFNAAPGLIPELDQVLRNEQVVTWDGVNLATRFGVPASSQAVLVP |
| Ga0334954_079380 | Ga0334954_079380_1_123 | F003495 | MDRSLVNRMKENNEKKMENCDEISKLIKAFPKDIAALDKRS |
| Ga0334954_086858 | Ga0334954_086858_2_121 | F003495 | MKENNEKKMENCDEISKLIKAFPKDIAALDKRSVLAKVNS |
| ⦗Top⦘ |