| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300033554 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133511 | Gp0348944 | Ga0326735 |
| Sample Name | Glacier ice microbial communities from Ngari, Tibet, China - 37_GP2_109.2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 365686799 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Extreme Environments Viral Communities From Various Locations |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Ice → Glacier → Ice → Extreme Environments Viral Communities From Various Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → glacier ice field → ice |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Ngari, Tibet | |||||||
| Coordinates | Lat. (o) | 35.2833 | Long. (o) | 81.4833 | Alt. (m) | N/A | Depth (m) | 109 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038578 | Metagenome / Metatranscriptome | 165 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0326735_1085577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 892 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0326735_1085577 | Ga0326735_10855772 | F038578 | MSEELVVLRGGSRDGESTRVQDGVRRILAASDAPGLLDVYEANGETAELAGNDELALVMIHVGQEPAGDDPGLPRGLE |
| ⦗Top⦘ |