| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300033157 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0141816 | Gp0395101 | Ga0369856 |
| Sample Name | Human adult male fecal microbial communities from Ikoma, Japan - F1-S |
| Sequencing Status | Permanent Draft |
| Sequencing Center | The University of Tokyo |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 38008638 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Ikoma, Japan |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Adult Male Fecal → Human Fecal Microbial Communities From Ikoma, Japan |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Japan: Ikoma | |||||||
| Coordinates | Lat. (o) | 34.7321 | Long. (o) | 135.7306 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F078693 | Metagenome | 116 | N |
| F092227 | Metagenome | 107 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0369856_100940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 3254 | Open in IMG/M |
| Ga0369856_117995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1137 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0369856_100940 | Ga0369856_1009403 | F078693 | MVFAPMRGAERFFIKADCSLLMSKENQKSTSDFDALDPRERGYSPLSDPEGVVEAQKC |
| Ga0369856_117995 | Ga0369856_1179952 | F092227 | MKEEKRKRILRVGCLILAGIFVLSMLGSVVMMLLV |
| ⦗Top⦘ |