NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300032891

3300032891: Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300032891 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128851 | Gp0330569 | Ga0314715
Sample NameMetatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21971387
Sequencing Scaffolds7
Novel Protein Genes8
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis1
Not Available2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.3956Long. (o)-85.3757Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000459Metagenome / Metatranscriptome1109Y
F006329Metagenome / Metatranscriptome376Y
F016911Metagenome / Metatranscriptome243Y
F042357Metagenome / Metatranscriptome158Y
F060513Metagenome / Metatranscriptome132Y
F082073Metagenome / Metatranscriptome113Y
F084981Metagenome / Metatranscriptome111Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314715_100381All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2147Open in IMG/M
Ga0314715_106319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis792Open in IMG/M
Ga0314715_106903All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum761Open in IMG/M
Ga0314715_107819Not Available717Open in IMG/M
Ga0314715_111242Not Available598Open in IMG/M
Ga0314715_112112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta575Open in IMG/M
Ga0314715_112688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii562Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314715_100381Ga0314715_1003812F016911VQGDRTAAVAAVERLHALAAEAARSEEDPSTSRARAPAKVPKVQPSDPDDVPVKTVQIGAGSSRTTRIAG
Ga0314715_106319Ga0314715_1063191F082073NPGSLLCQRILAAAKELFLKESMPSKKQSQSSVKPTGDVGTKTIQLQEGDDSKTAIIGAGLGDK
Ga0314715_106903Ga0314715_1069032F060513MSTTEIPEETGQTASADRSDRSCLVQHTGSTGQTGHPDRSDRSNAEWLQQRLDQYRARTNDMCEAIEDSGDLDKLGQGFTSADPLEKVDIGDGTIPRPTFVNK
Ga0314715_107819Ga0314715_1078192F006329NLVEKENEYLKEKLKKVEEEKMILELYVADVVGDHKNKMDAMRMKIRKIRKYAVTTEAWYHYVVGAIVTFVAILIAFIVAFKCFR
Ga0314715_109959Ga0314715_1099591F000459VRNGVLKLVDKIKRDRGRPKLTWDESVKRDLKDWDISEEVALDRSAWRLAINVPES
Ga0314715_111242Ga0314715_1112422F084981SGAAHLAPDAQQCPYGTLRARPLGPRLYELLLLLRTCEAPVAGDLLASLVQCDARSLAKPLLLGTSAVCGLTVVESETRVCSAPETAQTALPLNLNLQLYLTDLTLLLLPQSWLWWPWHL
Ga0314715_112112Ga0314715_1121122F042357MDLKPTRNSLGRNPLSDALHRNPGVVINGQGPGRHPPKGASYHDLGTMISEQGSGRHLNGALHLRPGVVKNEQGSLHFPRRVRRVRKLAEPTRIRIGSWNVGSLTGKLRELVDVAI
Ga0314715_112688Ga0314715_1126882F016911AIIGRPALYRFMAIAHYGYLVLKMPSPAGVLTVQGDRTAAVAAVERLHTLAAEAARSEEDPSTSQPRAPAKAPKVQPSDPDQVPVKSVQIGADTTRTTRIAGNLEEK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.