3300032135: Cryopeg brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - CBIA 2018

Overview

Basic Information

• IMG/M Taxon OID: 3300032135
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133511 | Gp0330628 | Ga0314774
• Sample Name: Cryopeg brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - CBIA 2018
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 246889181
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Extreme Environments Viral Communities From Various Locations
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Coastal → Unclassified → Cryopeg Brine → Extreme Environments Viral Communities From Various Locations

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → area of sea ice → brine
• Earth Microbiome Project Ontology (EMPO): Unclassified

Location Information

• Location: USA: Alaska
• Coordinates
  • Lat. (^o): 71.2944
  • Long. (^o): -156.7153
  • Alt. (m): N/A
  • Depth (m): 7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038088	Metagenome	166	N
F102169	Metagenome / Metatranscriptome	102	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0314774_1013796	All Organisms → Viruses → Predicted Viral	2622
Ga0314774_1020028	All Organisms → Viruses → Predicted Viral	1941

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0314774_1013796	Ga0314774_10137966	F102169	MAGVTNRTACQFNLKTIGKNGNRVTVRVVPGFNVVDDKHWAEFVGIDGKTIDPYVAGLKEKGDLVFGKGEDEKELESEVTKSKSKSTAMPKPAKK
Ga0314774_1020028	Ga0314774_10200283	F038088	QAKDPLIFLESVMNGKDPRNMSRLYKLVAEISDFSDGEIHPSDWAEVVDLVLADHKYRPVGIGESITAAKTMAEYMYPKRKQIDTNGGSGANGSVSNSPLTEEEIELFKERFNDEF