3300031953: Cryopeg brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 CB1W

Overview

Basic Information

• IMG/M Taxon OID: 3300031953
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133511 | Gp0330634 | Ga0314855
• Sample Name: Cryopeg brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 CB1W
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 22202352
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hydrotalea → unclassified Hydrotalea → Hydrotalea sp. AMD	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Extreme Environments Viral Communities From Various Locations
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Coastal → Unclassified → Cryopeg Brine → Extreme Environments Viral Communities From Various Locations

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → area of sea ice → brine
• Earth Microbiome Project Ontology (EMPO): Unclassified

Location Information

• Location: USA: Alaska
• Coordinates
  • Lat. (^o): 71.2943
  • Long. (^o): -156.7153
  • Alt. (m): N/A
  • Depth (m): 7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035569	Metagenome	172	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0314855_103160	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hydrotalea → unclassified Hydrotalea → Hydrotalea sp. AMD	1288

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0314855_103160	Ga0314855_1031605	F035569	MNKHEKLIEMMRITGKGKMACEICLQLCGYDMEKTLERMQRSYPSMEVKK