NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031714

3300031714: Metatranscriptome of enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Bagasse, Gen9, Rep 2, Chloramphenicol (Eukaryote Community Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300031714 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118397 | Gp0321452 | Ga0307465
Sample NameMetatranscriptome of enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Bagasse, Gen9, Rep 2, Chloramphenicol (Eukaryote Community Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size31670592
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Chytridiomycota → Chytridiomycota incertae sedis → Neocallimastigomycetes → Neocallimastigales → Neocallimastigaceae → Neocallimastix1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDetermining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: California
CoordinatesLat. (o)34.4149Long. (o)-119.841Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046107Metagenome / Metatranscriptome151Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0307465_115723All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Chytridiomycota → Chytridiomycota incertae sedis → Neocallimastigomycetes → Neocallimastigales → Neocallimastigaceae → Neocallimastix647Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0307465_115723Ga0307465_1157231F046107ENTMYFGKLYYAGIFPFLTNKKEIKPRSNIFKIDSVVSTKLSPDSSFIELLRRDSPFVVIDDDPVLSLCLISTTSKLLVKFGILQYLSNNSSNELLMIGIVYYKKNYTLLVSVIRLCPLL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.