NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031025

3300031025: Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome) (pilot)



Overview

Basic Information
IMG/M Taxon OID3300031025 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128851 | Gp0242470 | Ga0214505
Sample NameMetatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome) (pilot)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size5420767
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.39Long. (o)-85.37Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026180Metagenome / Metatranscriptome198Y
F086473Metagenome / Metatranscriptome110N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0214505_103032Not Available538Open in IMG/M
Ga0214505_103549Not Available500Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0214505_103032Ga0214505_1030321F086473VASTFKNLTSTTTHRDLSKFINIDGVSQEVMISNTTPSVVLILITESKQANPIKLASDRQSLDFYRSYKLSNYSNSGLVF
Ga0214505_103549Ga0214505_1035491F026180SCPVHPTARHSAADCREIQKLVKRVSGRREQSSKNGSPPPRQRAGKEKASDSRAAAGEKELGYQSPARELKGVYHNDDSDSDNGDRRKKLYVMYGGSWELVSRRDVKTLRREVLSVKPGVPRAAPHQRWMNTIISFGPSDCPENMAGAGVLPLVTAPVISNVRLYH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.