3300030710: Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - TR-2 (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300030710
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0135150 | Gp0323844 | Ga0307923
• Sample Name: Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - TR-2 (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 9451667
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From Risofladan, Vaasa, Finland
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → land → soil
• Earth Microbiome Project Ontology (EMPO): Unclassified

Location Information

• Location: Finland: Risofladan, Vaasa
• Coordinates
  • Lat. (^o): 63.0472
  • Long. (^o): 21.7116
  • Alt. (m): N/A
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001346	Metagenome / Metatranscriptome	718	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0307923_102647	Not Available	811

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0307923_102647	Ga0307923_1026472	F001346	VKTFRASAMTRTVTAELWTKGNLREKRRDPWHRANAPPKAVADPALIGQDAEKKSQACLDLVRKPVVQTLAEAS