NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300030700

3300030700: Metatranscriptome of enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Alfalfa, Gen0, Rep 1, Penicillin and Streptomycin (Eukaryote Community Metatranscriptome) (v2)



Overview

Basic Information
IMG/M Taxon OID3300030700 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118397 | Gp0306429 | Ga0307896
Sample NameMetatranscriptome of enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Alfalfa, Gen0, Rep 1, Penicillin and Streptomycin (Eukaryote Community Metatranscriptome) (v2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size65256056
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDetermining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: California
CoordinatesLat. (o)34.4149Long. (o)-119.841Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086383Metagenome / Metatranscriptome110N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0307896_122261Not Available913Open in IMG/M
Ga0307896_123681Not Available850Open in IMG/M
Ga0307896_134017Not Available542Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0307896_122261Ga0307896_1222611F086383QKSYAVKTIFPLQDESIQSILAGYDLTFSEKTMIAALDRSITWNNQNFSNYDIVIWQTSILSSYVFHTNESVKPSFIKNINRFVPNMDIIVVVQPLEDKNQIIQKFNEVIQQFDNVYPVNFVYGGVDLTFKEAIETIFEVLPTCNWCGRLFTKTTHFKKYCCSNCKDYAKEEQNRQNFRNYYKRYKDTMSEAQKGALGSRGANLHAHANSDHEVEARLISNEKKRLGL
Ga0307896_123681Ga0307896_1236811F086383VTLHIALDGIYVNVNHIIVQKLVEYLASKSYTVKTIFPLEDEIMQSILNSYDLTFSERALLAALDRSINWNHENFSNFDIVIWQTSILSSYAFHTNPEVKPSFIKTINKFVPNMDIIVVVQPLQEDNQIIQKFNDLIQQFNNVYPVNFVRGGVDLTFKEAIETIFEVLPTCNWCGRLFTKTIHFKKYCSNKCKDYAKEEQNRQNFRNYYKRYKDTMSEAQKG
Ga0307896_134017Ga0307896_1340171F086383ALDRSITWNNQNFSNYDIVIWQTSILSSYVFHTDQNVKPSFIKSINRFVPNMDIIVVVQPLEEKNQIIQKFNDFTKQFDNVYPVNFVNGAIDLTFKEAIETIFEVLPTCNWCGRLFTKTTHFKKYCSKNCKDYAKEEQNRLNFRNYYKRYKDTMSEAQKGALGSRGANLHAHANTDPEVE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.