NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029931

3300029931: Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V90308



Overview

Basic Information
IMG/M Taxon OID3300029931 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118585 | Gp0137253 | Ga0119911
Sample NameActivated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V90308
Sequencing StatusPermanent Draft
Sequencing CenterCalifornia Institute of Technology
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size14218327
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameActivated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationAustralia: Queensland
CoordinatesLat. (o)-27.49999Long. (o)153.01209Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002371Metagenome / Metatranscriptome566Y
F009328Metagenome / Metatranscriptome319Y
F091594Metagenome / Metatranscriptome107Y
F100051Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0119911_100310Not Available5422Open in IMG/M
Ga0119911_101582Not Available1430Open in IMG/M
Ga0119911_102762All Organisms → cellular organisms → Bacteria892Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0119911_100310Ga0119911_1003106F009328MKKEGYWCVVCGRFLAADNAGVIVHDDVPHPETMTFNEEDVQQ
Ga0119911_100310Ga0119911_1003107F091594MSEQAIKTFCLGNGEIGCDGCEQEKNWQTLNQMPNALRLAMQDTARRIDDTECILRGRLWRT
Ga0119911_101582Ga0119911_1015822F002371MKKKKETRGGTRKNAGAKPKYNEETKTVAFRCPLSKVDELKLIVKSKLSEWSLK
Ga0119911_102762Ga0119911_1027621F100051RLICAVFGHRYVVERVLNHGARKVGCTRCGKHWGMHDGTRSFVPWDGELEALYAPGGILAQASGDVPPNAQITGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.