NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029755

3300029755: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 050_3_14_stool_2



Overview

Basic Information
IMG/M Taxon OID3300029755 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133117 | Gp0283007 | Ga0243846
Sample NameHuman feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 050_3_14_stool_2
Sequencing StatusPermanent Draft
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size175791437
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → unclassified Subdoligranulum → Subdoligranulum sp. APC924/741
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078822Metagenome116N
F087336Metagenome110N
F089005Metagenome109N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0243846_102101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii13145Open in IMG/M
Ga0243846_130011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → unclassified Subdoligranulum → Subdoligranulum sp. APC924/74606Open in IMG/M
Ga0243846_133274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes536Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0243846_102101Ga0243846_10210115F089005LTKSKQRSIIVLALLRLATSNEESKQALKVRRTLKIEQRENSKETRNDFEESSKNYSEMYTKKHQELR
Ga0243846_130011Ga0243846_1300113F078822NAFLKAFHPHAVRFPAAFLLVHRFYLVFEELLSCAAAYL
Ga0243846_133274Ga0243846_1332742F087336VAELEQVPKAFRAAGNQRRAATKERIKDDAIGRGRVSDRILAEIEDNHMRERDTKIGLAEQRQVAFLEIAFQIL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.