3300029754: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 041_10_29_stool_1

Overview

Basic Information

• IMG/M Taxon OID: 3300029754
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133117 | Gp0282939 | Ga0243778
• Sample Name: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 041_10_29_stool_1
• Sequencing Status: Permanent Draft
• Sequencing Center: Institute for Genome Sciences, University of Maryland School of Medicine
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 157545345
• Sequencing Scaffolds: 0
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: USA: Baltimore
• Coordinates
  • Lat. (^o): 39.28846264
  • Long. (^o): -76.62594594
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101356	Metagenome	102	N

Associated Scaffolds

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0243778_128473	Ga0243778_1284731	F101356	KDGLSNSKFATTKIKSEGKRSVLLYRSSSSQWAPFAIRVSCISTGEPLSDFCVYIAGNTMELQDSTKVYVKYLYGQPNSDTYLKMKYETDHRISIYLTSDNSLGDRTIVRELIVRDSMYDMATQDDEITGLADCTIVQ