3300029726: Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37297R1

Overview

Basic Information

• IMG/M Taxon OID: 3300029726
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133139 | Gp0283837 | Ga0245201
• Sample Name: Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37297R1
• Sequencing Status: Permanent Draft
• Sequencing Center: Beijing Genomics Institute (BGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 134705751
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: United Kingdom: London
• Coordinates
  • Lat. (^o): 51.5
  • Long. (^o): -0.12
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061388	Metagenome	132	N
F089005	Metagenome	109	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0245201_106634	All Organisms → cellular organisms → Bacteria	2847
Ga0245201_117863	All Organisms → cellular organisms → Bacteria	1076

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0245201_106634	Ga0245201_1066344	F061388	MPEGGADMGGRGGSSHRQTAGGTAAIQTFLQNAYGANHANAVLAILQNAPAHIRALWEQYAVQFRATNMRRDEGAFYSPRDDSVHLHIPSVARGDAISTPYSVLFHEYGHMTDYLIARTHNQGNYSAYSDLFQGIGSDGKAIIRSGSSGGLLGRTAKDELEGHLARMRRQNPNLNRQQAARALVSEANSKYSYRDRSDISDMFEGAGLGIAHPLGAGHGLDYWISRGNSREIFAEIISAEAAHPGSLKAIKEYFPRTYQVYQDMMKARKKR
Ga0245201_117863	Ga0245201_1178632	F089005	LTKSKQRSIIALALLRLATSSEESKQALKVRRTLKIEQRDNSKETRNDFEESSKNYSEMYTKKHQE