Basic Information | |
---|---|
IMG/M Taxon OID | 3300029694 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133139 | Gp0283882 | Ga0245247 |
Sample Name | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36982 |
Sequencing Status | Permanent Draft |
Sequencing Center | Beijing Genomics Institute (BGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 183342655 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Ruminococcaceae bacterium LM158 | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | United Kingdom: London | |||||||
Coordinates | Lat. (o) | 51.5 | Long. (o) | -0.12 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032286 | Metagenome / Metatranscriptome | 180 | Y |
F056682 | Metagenome | 137 | Y |
F092228 | Metagenome | 107 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0245247_100126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Ruminococcaceae bacterium LM158 | 135252 | Open in IMG/M |
Ga0245247_101809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 15596 | Open in IMG/M |
Ga0245247_126966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 872 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0245247_100126 | Ga0245247_10012667 | F032286 | MVKWVCQIVTPIRHRALIFDARLFAGNTVDDALVTGGTFRFCRLMCLCVKRRNIMLNDKRRSLLNSALFRADYRTEQKTISPFSLALILTFDFAALSERRSCPEDRSRRFVLLGALDAALRQRTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENALKNADFHAHGQDRERAEI |
Ga0245247_101809 | Ga0245247_1018093 | F092228 | MKKKCTLVLISVLTVACIVSAYLLFFYNPSFNMVYDSDTDLYFNNSYLSYNDGTLAAADYRKTKVTAYDSKNNSTVNLPSNGCLINDNLFYINGDKLCCLDTTTNTRKIIDTDCRSFVCNNEVIAYTKNDSVILKDSDTLENIGDIKFDNQIYYINISDGNLYIAERIFEDKTDEYGYSFKVGKQYIFKKYDLKSCKLLKSKNANYVNGIRYVTVCQDTFYFFCDETQTVNNVCLDKDVNYPTIQHPDVKFITSNNDCVYYISEKTESAIILKTVESPYNGIWKLEVGSNKPVKIADKCDCDELLATKNFLYCYTINYILPRGVADLWVKGYLIDQLAIS |
Ga0245247_126966 | Ga0245247_1269663 | F056682 | KAANQPIRQGEIYSASFGAFPSKNRSTFPIQKLGKIYENQEVL |
⦗Top⦘ |