Basic Information | |
---|---|
IMG/M Taxon OID | 3300029678 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133139 | Gp0283831 | Ga0245195 |
Sample Name | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37271R1 |
Sequencing Status | Permanent Draft |
Sequencing Center | Beijing Genomics Institute (BGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 162383013 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | United Kingdom: London | |||||||
Coordinates | Lat. (o) | 51.5 | Long. (o) | -0.12 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092228 | Metagenome | 107 | N |
F097493 | Metagenome | 104 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0245195_100003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 520411 | Open in IMG/M |
Ga0245195_121901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 737 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0245195_100003 | Ga0245195_1000034 | F092228 | MKKKCTLVLISVLTVACVVSAYLLFFYNPSFNMVYDSDTDSYFNNSYLSYNDGTLAAADYRKTKVTAYDSKNNSTVNLPSNGCLINDNLFYINGSKLCCLDTTTNTRKILDTDCRSFVCNNEVIAYTKNDSVILKDSDTLENIGDIKFDNQIYYINISDGNLYIAERIFEDKTDEYGYSFKVGKQYIFKKYDLKSCKLLKSKNANYVNGIRYVTVCQDTFYFFCDETQTVNNVCLDKDVNYPTIQHPDVKFITSNNDCVYYISEKTESAIILKTVESPYNGIWKLEVGSNKPVKIADKCDCDELLATKNFLYCYTINYILPRGVADSWVKGYLIDQLAIS |
Ga0245195_121901 | Ga0245195_1219012 | F097493 | MYKFYSKNGQAQFYEHGVEIDGTVYGIHADRDILRIKRRIVNDKFAETDDNFDMDTEIAKIQHTSITFKQPTSEQLSQIQAETYNSMTELKQHVQSIMNGELTQDEINAMLMLQIAELKAGVDGE |
⦗Top⦘ |