NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029602

3300029602: Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_RA_Trp1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300029602 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116197 | Gp0321357 | Ga0307370
Sample NameMetatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_RA_Trp1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size73215721
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameActive Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations
TypeEngineered
TaxonomyEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: Wisconsin
CoordinatesLat. (o)44.11Long. (o)-88.23Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082739Metagenome / Metatranscriptome113N
F092888Metagenome / Metatranscriptome107Y
F105254Metagenome / Metatranscriptome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0307370_124051All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon779Open in IMG/M
Ga0307370_124553All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon766Open in IMG/M
Ga0307370_129554All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon666Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0307370_124051Ga0307370_1240512F092888MPGPASARGNYGMQPRNNKTIPTTSEGSQVHEQGKLEQNQNLFTLRVRKASGTIEFLSIGVCFTVVSIILIQAMATGQTAWNHAAFEPASSLVLAVVGYAGFMTSWKETSIAVDGLARRFTATTRNLLTRSSHEHEVPLPGIQAMDTEVDERTNTVRVTISRDNRETIRFQLDCNSYGPLEKYLKALLPKIPIITRD
Ga0307370_124553Ga0307370_1245531F082739SAAIIGISAAEIQKDFRYTDVDFTPVDTNGTEDISDDLLLPAVLGDLLPDGDGNGFFDVSYVLKKNGKVASTNPGQLYGVITVNNTTASSFTVTDTFGPQFNIHPAKLCGGVDIIRVDAGGYVTELSGTDQVVSAAVDNDANTVSLEIALDEPLATDEELMIYLKFQTALKKMLPDSNTFVNEATVNGETANATIEFV
Ga0307370_129554Ga0307370_1295541F082739GYEIQGDTNMRKLLCILLVISAAIIGISAAEIQKDFRYTDVNFTPIDTNGTEDISDDILLPAVLGDLLPDGDGDGFFDVSYVLKKNGMVASTNPGQLYGVITVNNTTATTFTVTDAFGPQFNIHPAKLCGGVDIIRVDAGGYATELSGTDQVVSAAVDNDANTVSLEIALDEPLATDEELMIYLKFQTALKKMLPDTNPFVNEATVNGEPANATVEFV
Ga0307370_139776Ga0307370_1397761F105254KKLMAEVATIYRLYGAAGTKYSLAGKTGRFCTQDSDPGLNNPCKIPPQGETYYSYRTTDCIGITGDFNQVRDIYIHCDGNFASEWGLDSGNGGGLFVGVRDAGDHGLPIDVVLHGSNQYAQATGTPGTTGHSIDDPTNGHPYYKDDPEKVRDFDTCLANSPLLIDSGPYTDDFYSKA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.